Protein Info for mRNA_2872 in Rhodosporidium toruloides IFO0880

Name: 11240
Annotation: HMMPfam-Pyridine nucleotide-disulphide oxidoreductase-PF00070,PRINTS-FAD-dependent pyridine nucleotide reductase signature-PR00368,PRINTS-Pyridine nucleotide disulphide reductase class-I signature-PR00411,SUPERFAMILY--SSF51905

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 12 to 326 (315 residues), 97.2 bits, see alignment E=3.3e-31 PF00070: Pyr_redox" amino acids 159 to 225 (67 residues), 29.1 bits, see alignment E=3.5e-10

Best Hits

KEGG orthology group: None (inferred from 45% identity to nfi:NFIA_032420)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (416 amino acids)

>mRNA_2872 HMMPfam-Pyridine nucleotide-disulphide oxidoreductase-PF00070,PRINTS-FAD-dependent pyridine nucleotide reductase signature-PR00368,PRINTS-Pyridine nucleotide disulphide reductase class-I signature-PR00411,SUPERFAMILY--SSF51905 (Rhodosporidium toruloides IFO0880)
MSSPPPPAPMKNIVVVGASYVGLAVANELSKVVDGEYRVVVVEKNSHFGHLFAYPRFAIS
PSHEHAAFIPFSTSSHSMLPSPHVIMHASALSLLPSNRILLDRSISLPSSPPSTELAYEA
LVLATGTKLSPPGTMPGGSKAEGVEYLRGSQGAMREAKRVVIVGGGAVGVQMATDLATLY
PPPQKHITLIQSRLLMPRFHPALHALVLRRLEELDVEVVLGSRAEVPREGWEGVGREGGT
VRLTDGREVEADYVIHALGQTPNSSLLSTLSPSSILPSGYIRVTPALLVSPSSASETAAL
GGRVFALGDVAESGAPKAARPALEQARIVAGNVVKVLQGQESESFETYTPTPAAIHLTLG
FRESVIFRNPPQSASGEWDGEPVVLWKDDGREDMGIRGVWERRLPGFAKREEDYHL