Protein Info for mRNA_2889 in Rhodosporidium toruloides IFO0880

Name: 11257
Annotation: K08184 SLC16A7 MFS transporter, MCP family, solute carrier family 16 (monocarboxylic acid transporters), member 7

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 transmembrane" amino acids 70 to 90 (21 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 135 to 161 (27 residues), see Phobius details amino acids 166 to 188 (23 residues), see Phobius details amino acids 196 to 217 (22 residues), see Phobius details amino acids 225 to 245 (21 residues), see Phobius details amino acids 284 to 305 (22 residues), see Phobius details amino acids 312 to 336 (25 residues), see Phobius details amino acids 346 to 368 (23 residues), see Phobius details amino acids 374 to 395 (22 residues), see Phobius details amino acids 407 to 432 (26 residues), see Phobius details amino acids 448 to 469 (22 residues), see Phobius details PF07690: MFS_1" amino acids 73 to 343 (271 residues), 61.7 bits, see alignment E=6.3e-21 amino acids 284 to 468 (185 residues), 51.7 bits, see alignment E=6.7e-18 PF13347: MFS_2" amino acids 191 to 452 (262 residues), 38.4 bits, see alignment E=6.3e-14

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (478 amino acids)

>mRNA_2889 K08184 SLC16A7 MFS transporter, MCP family, solute carrier family 16 (monocarboxylic acid transporters), member 7 (Rhodosporidium toruloides IFO0880)
MASSAIELESLGAPTPVDSPATSRPESIVSLNPCTHRRRSASLSRDTDVPPDNKEAFDSY
PEWNGGWKQVLACFALFFTTLGGVYSWGVFQDALVTAGLAPSSTLAFIGSVQATMEAILA
IPIARVVSAYGPRRVALVGSAFVGLGSILAGWCTHSVAGLIITEGFMFGIGQALCFFSAA
TLPTMYFLRSRNVATGMVYSGAGLGGAVFSLVTAQLLKRLHSLPWTFRTVGLIMTAINVP
AALVLKSRGEQVPFRGGKDKKVDAEERSTGSKYFDRTLFKDPRFCLILTGTAVGLFPLFV
PPLFLPLYSTSIGLSTTTAALILAGFNLSSALGRICFGLGADRLLGSLNALVLCLVTVSV
STLLIWPFANALAPLIVFSVINGFCAGGMFSLIPGTLSSVFGTRRLTVIFSMIVTSWSLG
YFLGAPIAGFLLQAYGGPDRGPKAYQPAIFYSGGLSVLAAVLVGAARFNISRTLWKKM