Protein Info for mRNA_2900 in Rhodosporidium toruloides IFO0880

Name: 11268
Annotation: BLAST pyridoxamine-phosphate oxidase [Moniliophthora ro...

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 146 transmembrane" amino acids 36 to 56 (21 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (146 amino acids)

>mRNA_2900 BLAST pyridoxamine-phosphate oxidase [Moniliophthora ro... (Rhodosporidium toruloides IFO0880)
MPFRGNAAPPRIVPPPVPPSQLPQHFAPTPLSRAGQIAAFALSAGIAVYGVLFYDYGEQE
HCFMPVRRWVDQHTASFFTLTPSERRYVSFSSTGVPMASASPADPPAAPTPELPHGVKPD
THTPFEYFKEHPVAFGKGKGEAERMV