Protein Info for mRNA_2904 in Rhodosporidium toruloides IFO0880

Name: 11272
Annotation: K03847 ALG12 alpha-1,6-mannosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 536 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 67 to 83 (17 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 126 to 144 (19 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details amino acids 184 to 211 (28 residues), see Phobius details amino acids 223 to 246 (24 residues), see Phobius details amino acids 278 to 302 (25 residues), see Phobius details amino acids 309 to 324 (16 residues), see Phobius details amino acids 330 to 352 (23 residues), see Phobius details amino acids 361 to 382 (22 residues), see Phobius details PF03901: Glyco_transf_22" amino acids 64 to 426 (363 residues), 136.1 bits, see alignment E=1.1e-43

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (536 amino acids)

>mRNA_2904 K03847 ALG12 alpha-1,6-mannosyltransferase (Rhodosporidium toruloides IFO0880)
MRIAPRGHEVLLVLVFAAHVLLVPPTKVEESFTLHFVRDVLVNGVEATGLKRYDHLEFTG
AVPRSTIGPLALAGLSSLPLRLASQLELVRSGSDAQLIVRLTLAFVNGLALAFFSRRVRA
AYGAKVAKYFLVLAATQFHVPFWAGRTLPNMLAFPLVQIALALLITPPVLSSVSKPRFST
RTHILGAFSILTFAAVIMRLELVALIAPFALEHLARRLIGPEQLVAMCLVTAAGSLGLSV
LADSYFWRGEAWLWPEGHAFLFNVLQGRSAEWGISPPLYYFTSALPKLLHLSLLPAVFSL
LADRRTRRLLFPCFAYVALLSLLKHKEWRFVVYVVPAFTVGAAAGIVAIGSLTASPQLRR
GLLLTIVAVNLLLTGLGLVASSANYPGYSAVTFLNNYLAENASSTDASGRPKHVHVGIEA
KMTGASNFVLLDSPHATRVKGDKVWYLSPSSWTPPPVHFDRSEDPAYSTLDSLVSSERFD
YALVDATALHDTAKRGDAEVLYEATAFDGFDWRAVAAGRWSEFTRKAVKVKVFKLR