Protein Info for mRNA_2910 in Rhodosporidium toruloides IFO0880

Name: 11278
Annotation: K03657 uvrD, pcrA DNA helicase II / ATP-dependent DNA helicase PcrA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 722 PF13604: AAA_30" amino acids 60 to 138 (79 residues), 30.9 bits, see alignment E=4.6e-11 PF00580: UvrD-helicase" amino acids 60 to 327 (268 residues), 222.3 bits, see alignment E=2.4e-69 PF13245: AAA_19" amino acids 64 to 311 (248 residues), 108.2 bits, see alignment E=1e-34 PF13361: UvrD_C" amino acids 333 to 499 (167 residues), 110.5 bits, see alignment E=2.4e-35

Best Hits

Predicted SEED Role

"ATP-dependent DNA helicase UvrD/PcrA" in subsystem DNA repair, bacterial UvrD and related helicases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (722 amino acids)

>mRNA_2910 K03657 uvrD, pcrA DNA helicase II / ATP-dependent DNA helicase PcrA (Rhodosporidium toruloides IFO0880)
MEPPDDLSDSEYLPRPVQGSSTTNAPAQQSAQPAERVTDGLKQSTLSFGRPSPSEYLAKL
NPAQREAVTASAEGGLAIHAGPGSGKTAVLTTRVAYVVQKGGIKPEELVVVTFTNKAANE
MKVRLSKIVGAETVDKLVMGTFHSVCVRYLRKYAKLVNLASNFLITDRDDCLGIIKRLLQ
ALPVPANLKREMKPQTWLESISKCKSRMMSADQYRADRSAAVDQEKVEWVARMYEAYEDA
LASGNALDFDDLLVRGYQLFRNHPRVIAKIKSVLIDEFQDTNSVQYDIVKLIAAPSGSLT
VVGDPDQSIYGWRNAEIENLEKMLKDFHPVRQIFLEENYRSTGAILGAALAVVRQDTKRI
NKSLTTSHPAGSSVVLHPAPSAQDEAAFIASTIKHLVAHLGGLVGYNDFAVLLRYGALSR
NIEVALQKAGIPSRMVGGHKFFERIEIKDMLCYLQLLSNPSYSPALMRIINVPRRAIGEK
TIREIVATAEKKKISPFEVCVKIANGQSIVQGMTTAQRKGIRTLVELVRDGRKKADEGVD
VASLIDLIVDRVGYRAHLDKQHSHDAAERWENVEELKAYATVVAQENPSTADLATAADPE
EGDSQFEEVTILPKNGSPAIKNDDSDIEIVESPKPKSRRRKGSEETEKLELTSSCGRSDD
TARGLPRHVYARHRHGDAGGQGRCEARAEGHDLDLPRRERTRMACRLHPGVRGRHLPLLP
LD