Protein Info for mRNA_2958 in Rhodosporidium toruloides IFO0880

Name: 11326
Annotation: K17907 ATG9 autophagy-related protein 9

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 853 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 350 to 369 (20 residues), see Phobius details amino acids 381 to 403 (23 residues), see Phobius details amino acids 423 to 443 (21 residues), see Phobius details amino acids 557 to 576 (20 residues), see Phobius details amino acids 602 to 625 (24 residues), see Phobius details amino acids 687 to 709 (23 residues), see Phobius details amino acids 721 to 739 (19 residues), see Phobius details amino acids 793 to 812 (20 residues), see Phobius details amino acids 832 to 852 (21 residues), see Phobius details PF04109: APG9" amino acids 348 to 841 (494 residues), 675.5 bits, see alignment E=2.6e-207

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (853 amino acids)

>mRNA_2958 K17907 ATG9 autophagy-related protein 9 (Rhodosporidium toruloides IFO0880)
MSLPHRLGTALFPATSVYADLDNPLDPFPNEPVDTRSSSSSADTRPGHHDGSLAPTGSRL
ADDDPFSAVTPSVLSPASARSRDAQLHPPPHLDQRGGQQDYEGARAGGTDVQEQDERDPF
AVDPTAASPKLDDSRALSPTPTGSLYLPAQDSSQQHPHFPPSHAPSTASVASSSRTRTSS
GAGGSKSAIGNRSLMGLLGGTRYEGGGFPFGGIGVGEVEEEDEEEDEEERVGMRHEEQGL
RTPRKDDLHDIAASLPPPPSALSSSSRDDEEEDDEAPPDFTSRIPLMASTSGRARVNPLQ
KARRAVSPSTASSSSHRTRRGAPVGGILGSTHIRRSLAGMNAKERALWRWVNVTDLDAFL
QQVYLYYVGKGIWAIGLERTLNLLTVGWVIGFSTFLVGCIDYPRLWDSHKLSEVVIPRCT
SRMSGFTLLLFIAFAAFYAWRVVRFGMGVRRLWDMHEFYTELLEVPESDIQTIPWHAIVA
RLSALRASHPSALSSRAHSSDPARQAERLDAHDVANRIMREENYLIALFNKSLLDISLPL
PQPVARLVGKKRFGKSMLTQTLEWNLSFCLLGFLFGRDGQVRRAFLSERNKKELVEALRR
RFILMGLINAVFAPFIVLYLLMYSFFRYFEEYHKNPSSIGSRQFTPLARWKFREFNELPH
HFQQRLALAHPLADQYINHYPKAKTVLLSRFVAFLAGSFAAVLILFSLIDPDAFLHFEIT
PGRTVLFYIGVFGTILAVARGMSPDDNRVVDPEELMRNIVEHTHYLPNEWKDKLHSAEVH
VAFGKLFQMKVSLFLQELFSVLITPVVLWYSLPKCAGPVVDFFREFTVHVDGLGYVCSFA
VSPTGGAFCAAAL