Protein Info for mRNA_2973 in Rhodosporidium toruloides IFO0880

Name: 11341
Annotation: K11996 MOCS3, UBA4 adenylyltransferase and sulfurtransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00899: ThiF
  • amino acids 77 to 331 (255 residues), 182 bits, E=1.3e-57
• PF00581: Rhodanese
  • amino acids 416 to 535 (120 residues), 22.1 bits, E=1.8e-08

Predicted SEED Role

"Sulfur carrier protein adenylyltransferase ThiF" in subsystem Thiamin biosynthesis

MetaCyc Pathways

• thiazole component of thiamine diphosphate biosynthesis II (4/7 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (3/7 steps found)
• superpathway of thiamine diphosphate biosynthesis II (5/11 steps found)
• superpathway of thiamine diphosphate biosynthesis I (4/11 steps found)

Protein Sequence (545 amino acids)

>mRNA_2973 K11996 MOCS3, UBA4 adenylyltransferase and sulfurtransferase (Rhodosporidium toruloides IFO0880)
MDEASSSRRSQLLRDLDEARSRVAQLEDQLAALSASDSQSGQFSSTAAQTEGGANGTEVV
NGRKKEWPLSSREYKRYGRQMLVSQIGLPGQLKLKKARILVVGAGGLGCPVLLYLAAAGV
GDITILDHDSVELSNLHRQVLHTEERVGMPKAESARIALQALNSDITIHSHVLPFTPALF
HPPLSTNSTPHSILEGIFDLVLDCTDNPATRHFLNAYAVSKGIPLVSGGAVRAEGTVGVY
GLPLPATEENRETARGPCYACLFPPSPPPPAPPSLSSDPAAFDKYYEQLSLAGTGACADE
GVVGVLCGVVGLGMVGEAMKVLLGTAKPALHLFSPLSSAPYRTIKTRSRKPTCPTCGTFP
SPSASSLTEASTPKSRWQSFLDSPTGEWPGWSDPLCELPGVGALASMEDRRVSVEEAKRR
LEEGQEDRRTRVIDTRSGTEFGIVSVDGSVNIPFPLLLRNPSLALAPSPPAHTSSPSDST
TSASPPERITFLCRRGNDSLLASRALRRYLASRPDESGKQIEVEDVKGGLEAWARASADE
GFPMY