Protein Info for mRNA_2976 in Rhodosporidium toruloides IFO0880

Name: 11344
Annotation: KOG2592 Tumor differentially expressed (TDE) protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 514 signal peptide" amino acids 12 to 15 (4 residues), see Phobius details transmembrane" amino acids 16 to 33 (18 residues), see Phobius details amino acids 54 to 79 (26 residues), see Phobius details amino acids 99 to 122 (24 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details amino acids 209 to 233 (25 residues), see Phobius details amino acids 240 to 264 (25 residues), see Phobius details amino acids 273 to 292 (20 residues), see Phobius details amino acids 311 to 331 (21 residues), see Phobius details amino acids 440 to 461 (22 residues), see Phobius details amino acids 485 to 509 (25 residues), see Phobius details PF03348: Serinc" amino acids 31 to 513 (483 residues), 504 bits, see alignment E=1.9e-155

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (514 amino acids)

>mRNA_2976 KOG2592 Tumor differentially expressed (TDE) protein (Rhodosporidium toruloides IFO0880)
MGALISIPFLGPIAGLGSSAVSACVTGLAFFCTGQAASALTKSCNCNSSVATRVGFSLIF
LLNSLFAWMMLTDFAIKLVAKWSWEWIKMECKEGKCYGVLAVHRICFALAMFHSVLSLLL
IGVKDTRTKRAAIQNGWWGPKVLAWLVFVYLSFLIPNGFFTSFWSTYISLPGSGIFILIG
LVLLVDFAHSWSETCLERWEATDSPFWKWVLISSTLGLYALTIALTVVQYVFFAGKGCGL
NTALIMTNWIISLVVSALSIAPAVQESNPRSGLAQAGMVVAYTAYLITSAIANHDDGNGA
CNPLQSRAAGARTGMVVLGAVFTFLAIAYSTSRAATQSKAFTPGRKGRPDSGEYEALSQS
MSGSGGVDVEGGEMGPVLTQPKRQESLRYQAIKAAVEEGSLPASALTDFDDDEVDESSAA
GGMSPLNDDERTGTRYNYSFFHLIFVLATMYTACLLTNWSTVSPITSTISPDGQPMRIGR
SHVAFWMRIISAWLCQAIYAWSLAAPLVLPDRFA