Protein Info for mRNA_2983 in Rhodosporidium toruloides IFO0880

Name: 11351
Annotation: K00993 EPT1 ethanolaminephosphotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 542 transmembrane" amino acids 50 to 73 (24 residues), see Phobius details amino acids 82 to 98 (17 residues), see Phobius details amino acids 134 to 159 (26 residues), see Phobius details amino acids 171 to 193 (23 residues), see Phobius details amino acids 200 to 217 (18 residues), see Phobius details amino acids 224 to 245 (22 residues), see Phobius details amino acids 275 to 295 (21 residues), see Phobius details amino acids 307 to 328 (22 residues), see Phobius details amino acids 337 to 359 (23 residues), see Phobius details amino acids 370 to 400 (31 residues), see Phobius details PF01066: CDP-OH_P_transf" amino acids 50 to 124 (75 residues), 54 bits, see alignment E=1.2e-18

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (542 amino acids)

>mRNA_2983 K00993 EPT1 ethanolaminephosphotransferase (Rhodosporidium toruloides IFO0880)
MPGVRHYLDLHHLRRLDEYAYSAVDKSPVSQYIMRHWWTWTASFAPPWLAPNAITVIGFC
AILLNTATVALVAGDLRGSENGWVWASCAAGLFFYQTMDNIDGKQARRTGTSSPMGELFD
HGLDTLNCPLGAVIQASALALGPSPLALLCILVPCWSMYVSTWEEYHTGTLYLGFVSGPV
EGILLAVLILTWTGIKGSSWWLLTVSEALGDVAVLPTSWRMNQLAVAFFTLAFVATQLPL
CLRNVHSQLTSPPRRSLTRPGRHSTTLNPPSPAEAFQQLFPIVGFSVLTVMWVLSPQSVM
LQGGGKLVEFALVVCYLFGQLSSKIILAHLTKGLFPFSWPLLIPLAIPAIAVNTPYLGLP
SLLPPTLETLYLHLLLALSLLSYTLSAHAVLSSFCGYLGISCLTIPFPNKAVEGWVPLPT
VKLHQSPRPPSMGEYGAQEEEETYPPASAPGRAPLALDRVRRWLDSAASSSSRGDGSSLG
VNGDAGGGGRKRSNTSEREREVGLGGGAASAAAPSPLGAGGAAGAAGQAARIAGSPRKGG
RA