Protein Info for mRNA_2994 in Rhodosporidium toruloides IFO0880

Name: 11362
Annotation: K14729 FOX2 multifunctional beta-oxidation protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 10 to 189 (180 residues), 157.5 bits, E=9.1e-50
  • amino acids 308 to 492 (185 residues), 142.8 bits, E=2.8e-45
• PF08659: KR
  • amino acids 11 to 176 (166 residues), 61 bits, E=4.4e-20
  • amino acids 309 to 464 (156 residues), 64.6 bits, E=3.6e-21
• PF13561: adh_short_C2
  • amino acids 16 to 201 (186 residues), 126.4 bits, E=4.1e-40
  • amino acids 314 to 485 (172 residues), 113.6 bits, E=3.3e-36
• PF01575: MaoC_dehydratas
  • amino acids 771 to 880 (110 residues), 110 bits, E=1.8e-35

Best Hits

KEGG orthology group: K14729, multifunctional beta-oxidation protein [EC: 1.1.1.- 4.2.1.-] (inferred from 65% identity to uma:UM00150.1)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of type II polyketide backbone
• Biosynthesis of type II polyketide products
• Biosynthesis of unsaturated fatty acids
• Bisphenol A degradation
• Butanoate metabolism
• C21-Steroid hormone metabolism
• Fatty acid biosynthesis
• Fructose and mannose metabolism
• Glycine, serine and threonine metabolism
• Insect hormone biosynthesis
• Limonene and pinene degradation
• Linoleic acid metabolism
• Nucleotide sugars metabolism
• Phenylalanine, tyrosine and tryptophan biosynthesis
• Polyketide sugar unit biosynthesis
• Porphyrin and chlorophyll metabolism
• Retinol metabolism
• Tetrachloroethene degradation
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-, 4.2.1.-

Use Curated BLAST to search for 1.1.1.- or 4.2.1.-

Protein Sequence (890 amino acids)

>mRNA_2994 K14729 FOX2 multifunctional beta-oxidation protein (Rhodosporidium toruloides IFO0880)
MAEQLRFDKKTVVITGAGGGLGRAYSLFFASRGANVVVNDLSRENAQKVVDEIKAMNGGR
AVANTDSVTEGKKIIEQAMNEFGSVDILINNAGILRDKSFKSMTDKEWDIIHDVHVKGAY
ACTKAAWPIMRKQKFGRIINTASAAGIYGNFGQANYSAAKMGLVGFAKTLAREGAKYNIH
ANAIAPVAASQMTETVMPPEMLANLSPEMIVPLVAYLCHDQTETNGQVFEAGAGWYGKLR
WERTKGHVFKTDSSFTPSAVKAKWDTINDFTDADHPENITDADYLGFLEKAKSMPTNESN
DDVRFEGKTVLITGAGAGLGRSYAHVFAKGGANVVVNDMSKDNAEKVVKEIKDAGGKAVA
VVESTLEGEKLVKAALDAFGSIHTIICNAGILRDKSFAAMTDAEWDAVYSTHLKGTYAVC
KAAWPHFQKQKYGRIVTTSSAVGVHGNFGQANYSTAKSAIIGLTRTLAIEGKKYGILANI
LVPNAGTAMTATIWPQEMVQAFSPDFVAPVVGYLGSEANQDTMGLYEVSAGWVASIRWQR
TAGHAFPVNQKVTPEDIVGAWDKITRFDENATNPNSTAESLESIISNFGNEDEGASSSGG
EDYTDPEDSELVAKAKKEAHSSGEYTYTERDIALYNLGIGATEKDLDLVFEGDENFQACP
SYGVIPQFATSSGLSLDWLPNFSPMMLLHGEQYLSIKKQIPTSGTLVSESKLAEVLDKGK
AAAVTTVTTTKDAATGDVVFENHSTVFIRQAGGFGGRKTGKDRGAATALNKPPSRKPDAV
VEEKTLPQQAAIYRLSGDYNPLHVDPNFAKVGGFDQPILHGLCSFGISAKHIFRKYGAFS
DIKVRFAGVLFPGETLVTEMWKEGDKVVFVTKCKERGTVVLSSAAATLAQ