Protein Info for mRNA_2999 in Rhodosporidium toruloides IFO0880

Name: 11367
Annotation: KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 544 transmembrane" amino acids 51 to 76 (26 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 119 to 135 (17 residues), see Phobius details amino acids 144 to 144 (1 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 175 to 196 (22 residues), see Phobius details amino acids 208 to 227 (20 residues), see Phobius details amino acids 319 to 341 (23 residues), see Phobius details amino acids 365 to 390 (26 residues), see Phobius details amino acids 411 to 430 (20 residues), see Phobius details amino acids 437 to 463 (27 residues), see Phobius details amino acids 475 to 494 (20 residues), see Phobius details amino acids 506 to 527 (22 residues), see Phobius details PF07690: MFS_1" amino acids 71 to 463 (393 residues), 79.7 bits, see alignment E=1e-26

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (544 amino acids)

>mRNA_2999 KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) (Rhodosporidium toruloides IFO0880)
MTPAAHRQYTHDTPPGTDILDADGKEHSVHYPMPSDSIHDPLVWKPAYKAVTYWLGVWWV
FWACLPVNAVPSIYGALIRDYHMTPAEISQVGGWNGLVLALAGFILLPYASAYGRRPMLL
FSNLVNIAGTIWATQTHSHLTFLWARNVEVIGAGALEVLALCLTGDMYFTQEAGLYHAIG
FAPLILATNIGAPIAGAFEQNNHGWRNFFWMCAGALIFTEIVLFFFFPETLWHRTNASAR
GEVVTVGDAAAPTDAEQDTGSLDEKAPRTPALAPVLTAEGLTTAQAAVIANVGKGYPTKQ
QRYSIFPPRNKHYSLVRNMLDIATLSTFGPVALFALWWAAIGGAATSSGFVAAQIWAAPP
YLFGPAAIGCTNIPPTIGIFLGLFIAGPIVDWDVAQQAKRNGGVREPEMRLRVAIAGGVV
AAVGNIIYGVGLQRHWHWAAVLVPGMGLNQFAAAFSIVAVSSYATDVYKQYPIEIAFITT
LAKNLWVFGLGYFMNALFERVGPLKMIVLISIPLYAAILITVAFIWVGKSTRRFSARFGI
MQRE