Protein Info for mRNA_3013 in Rhodosporidium toruloides IFO0880

Name: 11381
Annotation: KOG1889 Putative phosphoinositide phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 658 transmembrane" amino acids 53 to 72 (20 residues), see Phobius details amino acids 542 to 562 (21 residues), see Phobius details amino acids 573 to 593 (21 residues), see Phobius details PF02383: Syja_N" amino acids 56 to 361 (306 residues), 285.6 bits, see alignment E=2.9e-89

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (658 amino acids)

>mRNA_3013 KOG1889 Putative phosphoinositide phosphatase (Rhodosporidium toruloides IFO0880)
MHLHDSYVLYTTKDAYTLVGQSEKAETLTISRGANSFSIKPGANPPPRPEQELVVYGLFG
VISLLKSDYLIVITKRTKVATVFTSPIYSANDFSVFPLERSSSAELVKHPQEAYLLGLIK
SHLYSAPFYFTYGGYNVTSRLQEQEPSEKPLWETADDRFFWNRHLQRRFIDAMTSAGQED
YSRFILPCIFGFLEFKHASINGRNFLFGLISRRNRYRAGTRYFSRGIDQAGNVSNFNETE
QIVLLDAQNGGGAAGSSGGAVRGDIRFSYVQTRGSVPVYWAEINNLRYKPDLKILDLSST
AESLSRHFDQQISLYGDQYLVNLVNSHGYEKPVKDAYERALNAMGNPRIHYTYFDFHKEC
KGLRFDRVSVLIDSLDQDLQQQGYFFHDTTAAKQPQRKQISVVRTNCMDCLDRTNVVQSA
LAKWVLNNQLRQIGVLSVKESVEEHAAFLNLFRNVWADNADVVSRAYSGTGALKTDYTRT
GKRSKEGALQDGINSAIRYIKNNFLDGPRQDAYDLVTGTWVPRKGEELGWADKRELAVRA
APWILLFGLFALFVTFFAAAFVNDYVASSRKVAIVSLALVAFAFNSILVNGIDYVSQPRL
ARQALDDILGYTGKGYESGRRGRPVKKKLVSVESSAKNRQARKESLLPSLSSPQIKQE