Protein Info for mRNA_3022 in Rhodosporidium toruloides IFO0880

Name: 11390
Annotation: K12394 AP1S1_2 AP-1 complex subunit sigma 1/2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 PF01217: Clat_adaptor_s" amino acids 12 to 151 (140 residues), 189.9 bits, see alignment E=1.1e-60

Best Hits

Swiss-Prot: 61% identical to AP1S1_SCHPO: AP-1 complex subunit sigma-1 (vas2) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: None (inferred from 81% identity to scm:SCHCODRAFT_80260)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (167 amino acids)

>mRNA_3022 K12394 AP1S1_2 AP-1 complex subunit sigma 1/2 (Rhodosporidium toruloides IFO0880)
MSSGLQERDNGVSFILLISRQGKVRLAKWYTTMPPRNKAKVVKDVTQLVLARRTRMCNFL
EYKDSKIVYRRYASLFFVCGIGPQDNELITLEVIHRYVEVLDRYFGNVCELDLIFNYQKA
YSILDELIIAGEMQESSKKSVLKAVGQADQIEEQELSEDPLGRLGQR