Protein Info for mRNA_3029 in Rhodosporidium toruloides IFO0880

Name: 11397
Annotation: K14688 SLC30A1, ZNT1 solute carrier family 30 (zinc transporter), member 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 42 to 60 (19 residues), see Phobius details amino acids 80 to 102 (23 residues), see Phobius details amino acids 114 to 133 (20 residues), see Phobius details amino acids 301 to 324 (24 residues), see Phobius details amino acids 336 to 356 (21 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 9 to 153 (145 residues), 116.7 bits, see alignment E=6e-38 amino acids 288 to 410 (123 residues), 88.9 bits, see alignment E=1.8e-29 PF01545: Cation_efflux" amino acids 11 to 350 (340 residues), 153.1 bits, see alignment E=4.2e-49

Best Hits

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (468 amino acids)

>mRNA_3029 K14688 SLC30A1, ZNT1 solute carrier family 30 (zinc transporter), member 1 (Rhodosporidium toruloides IFO0880)
MATQRRAFKLKLLLAIDTAFLFLELGVGIVVGSLALVADSFHMLNDVCSLIVALQALKLA
ENKSSSSKLSYGWQRAEVLGALINGVFLLALCFSIGMEAIARFVNYTEVTQPKLIVAVGS
AGLLSNIIGLFLFHDHGGHSHGGGGHGHSHGGSASATKASHGGHSHANGHAHDEPSDRTP
LLSRNGRGDSSAHSSRPASPAHLSASSSTAIDDADTASDAGLSDVSAEEELFVHPGELRA
NVLKKAHDAGYGATTGVSGSASQAARDIESQLGGEHAHDEGHGGHGGHGGHGEGSMNMKG
VFLHVLGDALGNVGVIAAGLFIWLTDYWWRSYFDPAVSLVITVIIKSASFILLQGVPSSV
PLERLRSSIAECPGVLNVHDLHVWSLSESKIVASVHIMVRGPDLVNVSREIKPAEIGLEQ
DGCPIVCVAPDCADNSCCPPPTTATGNGASGGATAVQPAIPGVTGRKR