Protein Info for mRNA_3053 in Rhodosporidium toruloides IFO0880

Name: 11421
Annotation: K06889 K06889 uncharacterized protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details amino acids 165 to 182 (18 residues), see Phobius details amino acids 203 to 219 (17 residues), see Phobius details amino acids 328 to 348 (21 residues), see Phobius details amino acids 369 to 388 (20 residues), see Phobius details PF12146: Hydrolase_4" amino acids 92 to 223 (132 residues), 34 bits, see alignment E=3.9e-12 PF00561: Abhydrolase_1" amino acids 93 to 200 (108 residues), 44.6 bits, see alignment E=3e-15 PF12697: Abhydrolase_6" amino acids 95 to 292 (198 residues), 31.4 bits, see alignment E=6.3e-11

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (393 amino acids)

>mRNA_3053 K06889 K06889 uncharacterized protein (Rhodosporidium toruloides IFO0880)
MAMYLSYLLPSLRTLLKVLGTTLALSVLGGGTALYLFQTRLIYPANLPAGSREHVPRPQD
FGMDGEEVELSSADGTKVKAFVILARDKPEERPTVLLLHANAGNVGHRLPIAKVFWSKMR
CNVVMLSYRGYGHSEGSPTEKGIKLDAQTCLDYLKSRRELEKTDVWLYGQSIGGAVAVWL
ASQNAERVRGLIIENTFLSLPKLIPHLLPFLRPFLPLLLTEIWPSENYITHLPRSFPVLF
LAGAKDELVVPGQMRGLWDLCRSERKEWREYEEGTHSESRGWFPLALAALEKIAACASGG
QIPRSEFLAPLTNRRHLRATALLCRHRLVHLLALFLSLRTLNLLDSYARLSALHLHYPAR
PDRSRTREARLLILALVARQLLRISRVVRARRR