Protein Info for mRNA_3077 in Rhodosporidium toruloides IFO0880

Name: 11445
Annotation: K07542 PIGV phosphatidylinositol glycan, class V

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 signal peptide" amino acids 19 to 19 (1 residues), see Phobius details transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details amino acids 147 to 163 (17 residues), see Phobius details amino acids 169 to 188 (20 residues), see Phobius details amino acids 196 to 219 (24 residues), see Phobius details amino acids 238 to 259 (22 residues), see Phobius details amino acids 309 to 328 (20 residues), see Phobius details amino acids 370 to 389 (20 residues), see Phobius details amino acids 425 to 444 (20 residues), see Phobius details PF04188: Mannosyl_trans2" amino acids 40 to 446 (407 residues), 175 bits, see alignment E=1.9e-55

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (447 amino acids)

>mRNA_3077 K07542 PIGV phosphatidylinositol glycan, class V (Rhodosporidium toruloides IFO0880)
MSLPCRWRDEALAHPTRAIVLASLTLRCLTSFLLLLVFSLNPSFDASAATLSHPVSPYLQ
PFVRWDTVYFVNIALEGYTQEQRAAFMPGLPGLMRAGGEGIRWLRGGKGAASGDDVVLAG
MTATAAAAIAAAVVLHRLTVRLFPRRSAFALTTALLFLLAPGRPTLHAVPYTEPFAALFT
FLGMLLFYKNRDATAAVAWALGTTMRAQGVVLGLGFFGWKWVLRRTWDGTSSGRLQRLAT
GIPVFAALSLLSSLPFLAFQRYVYTLFCSEPSSLRPWCTEGLGFSYGWIQSEYWDVGLFR
YWTLLQLPNFLLAAPVLALSLAASYSFYRSNLAFTLRSTLPFLPLSLAPSAPPRHANPSE
PLSNPSSPSATLALIPLIHLHTLLTLLLLTTAHVQIVLRVCVTNPVVWWYAAELVCSGSR
WGRRWVVYCVVWGTVATGLWAVFLPPA