Protein Info for mRNA_3087 in Rhodosporidium toruloides IFO0880

Name: 11455
Annotation: HMMPfam-haloacid dehalogenase-like hydrolase-PF12710,SUPERFAMILY--SSF56784,TIGRFAM-HAD-SF-IB HAD phosphoserine phosphatase-like hydrolase, family IB-TIGR01488,TIGRFAM-DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase-TIGR01489

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 TIGR01489: 2,3-diketo-5-methylthio-1-phosphopentane phosphatase" amino acids 12 to 200 (189 residues), 130 bits, see alignment E=1.2e-41 PF06888: Put_Phosphatase" amino acids 13 to 153 (141 residues), 32.4 bits, see alignment E=1e-11 TIGR01488: HAD phosphoserine phosphatase-like hydrolase, family IB" amino acids 13 to 194 (182 residues), 84.4 bits, see alignment E=9.3e-28 PF12710: HAD" amino acids 15 to 192 (178 residues), 68.3 bits, see alignment E=1.9e-22 PF05822: UMPH-1" amino acids 84 to 194 (111 residues), 30.3 bits, see alignment E=4.6e-11

Best Hits

KEGG orthology group: None (inferred from 57% identity to cci:CC1G_10714)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (250 amino acids)

>mRNA_3087 HMMPfam-haloacid dehalogenase-like hydrolase-PF12710,SUPERFAMILY--SSF56784,TIGRFAM-HAD-SF-IB HAD phosphoserine phosphatase-like hydrolase, family IB-TIGR01488,TIGRFAM-DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase-TIGR01489 (Rhodosporidium toruloides IFO0880)
MSPSLPHSDARFLLFSDFDGTITLRDSNDCATDELGFGVVRRRELNVEILNGQKTFRDAF
AEMLESVWKNGHQFEDVKQYLVKHISLDPGFKSCFQWCEGHDVPVIIVSSGMKPIIEAVL
TNLVSEKDAANIDIISNDVEIAADGAWKIKYRHPESGFGHDKSKATAPYRDLPHRPTILF
CGDGVSDLSAAKAADLLFVKVVPGHTNDLAVHCDREKIPYVAFEHFEQVKEVVARLVEGK
STIQEELAKK