Protein Info for mRNA_3097 in Rhodosporidium toruloides IFO0880

Name: 11465
Annotation: K00591 COQ3 polyprenyldihydroxybenzoate methyltransferase / 3-demethylubiquinol 3-O-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01983: 3-demethylubiquinone-9 3-O-methyltransferase
  • amino acids 70 to 310 (241 residues), 221.8 bits, E=3.6e-70
• PF13489: Methyltransf_23
  • amino acids 100 to 292 (193 residues), 81.1 bits, E=3e-26
• PF06325: PrmA
  • amino acids 121 to 244 (124 residues), 24.3 bits, E=6.9e-09
• PF13649: Methyltransf_25
  • amino acids 125 to 237 (113 residues), 45.1 bits, E=4.7e-15
• PF08241: Methyltransf_11
  • amino acids 126 to 241 (116 residues), 64.7 bits, E=3.5e-21
• PF08242: Methyltransf_12
  • amino acids 126 to 239 (114 residues), 47.4 bits, E=9.6e-16

Predicted SEED Role

"3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)" in subsystem Ubiquinone Biosynthesis (EC 2.1.1.64)

MetaCyc Pathways

• ubiquinol-8 biosynthesis (early decarboxylation) (3/8 steps found)
• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (5/12 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-6 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-10 biosynthesis (late decarboxylation) (2/9 steps found)
• ubiquinol-6 biosynthesis from 4-aminobenzoate (yeast) (2/9 steps found)
• ubiquinol-8 biosynthesis (late decarboxylation) (2/9 steps found)
• superpathway of ubiquinol-6 biosynthesis (late decarboxylation) (3/11 steps found)
• superpathway of chorismate metabolism (28/59 steps found)

KEGG Metabolic Maps

• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.64

Protein Sequence (334 amino acids)

>mRNA_3097 K00591 COQ3 polyprenyldihydroxybenzoate methyltransferase / 3-demethylubiquinol 3-O-methyltransferase (Rhodosporidium toruloides IFO0880)
MLRSTGCRRLARAFRHAQSVPSLSAGQPTGSSPLPNLITSVPSASSSHRTLTTSRPFRHQ
NSTNTISASEISHFSALSAHWWDPTGEFGLLHRMNPARIEVLRDEILRVEEVDVEGGRWL
EGRTVLDVGCGGGIFAESLTRLGADTLAIDASASNITTAQTHASLDPSLNLLNSPIPVPS
SSSNRPTNSLEYRHCAAEDLVKEGKQFDVVCAMEVVEHVEDPRGFLECLMQLTKPGGHLI
LSTISRTPLAKLLTITLAEDVLRLVTPGTHTYHKYLRPTELRDFFREKGWEAFETRGVPY
DPVKGEWRLLDPGALGGWGEMVNYFAAVRRPRVQ