Protein Info for mRNA_3124 in Rhodosporidium toruloides IFO0880

Name: 11492
Annotation: K04079 HSP90A, htpG molecular chaperone HtpG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 797 PF13589: HATPase_c_3" amino acids 123 to 244 (122 residues), 41.8 bits, see alignment E=1.4e-14 PF02518: HATPase_c" amino acids 125 to 279 (155 residues), 55.5 bits, see alignment E=1.2e-18 PF00183: HSP90" amino acids 282 to 780 (499 residues), 775.3 bits, see alignment E=5.6e-237

Best Hits

Swiss-Prot: 71% identical to HS901_ARATH: Heat shock protein 90-1 (HSP90-1) from Arabidopsis thaliana

KEGG orthology group: K04079, molecular chaperone HtpG (inferred from 80% identity to cci:CC1G_03927)

Predicted SEED Role

"Chaperone protein HtpG" in subsystem Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (797 amino acids)

>mRNA_3124 K04079 HSP90A, htpG molecular chaperone HtpG (Rhodosporidium toruloides IFO0880)
MLARCGWVARSLDSVYSDSLDQFPYRTARNEVGEWSSGVEELGGTASPCSTSLSLSFPHL
CTRCNCSSSHLTVASTATHSHHSHLSLLHPSVHPKTLSATMAESFAFQAEITQLLDLIIN
TFYSNKEIFLRELISNSSDALDKIRYAALTDPTQLDSEKELFIRITPDKANKTLTIRDSG
IGMTKADLVNNLGTIAKSGTKAFMEALSSGADISMIGQFGVGFYSAYLVADKVTVITKHN
DDEQYVWESSAGGTFTITPDTTNPSLGRGTQMILHMKEDQLEYLEEKRIKDIVKKHSEFI
SYPIQLVTTKEVEKEVEEEEEESADSDKPKIEEVDDEDKKDKKKKTVKENVTEQVELNKT
KPLWTRNPQDITAEEYGAFYKSLTNDWEDHLAVKHFSVEGQLEFKAILFIPKRAPFDLFE
SKKKRNNIKLYVRRVFIMDDCEDLIPEYLNFIKGIVDSEDLPLNISRETLQQNKILKVIR
KNLVKKALEMVQDIAEDKDNFAKFYEAFGKNIKLGIHEDSQNRSKLAEFLRFHSTKSGDE
MTSLKDYITRMPEHQKNIYYLTGESLNQVRDSPFLEIFKKKGFEVLLMVDPIDEYATTQL
KEFEDKKLVCISKEGLELEETDEEKKAREEEAKQFEDLTRTMKEVLGDRVEKVTISNRIA
DSPCILVTGQFGWSANMERIMKAQALRDASMSSYMMSKKTLEINPNNAIIRELKNKVQAD
SADKAVRDLVVLLYETALLTSGFTLDEPHHFAERIHAMISLGLSIDADEPAAAAHAEQDD
QPPALEATGASSMEEVD