Protein Info for mRNA_3143 in Rhodosporidium toruloides IFO0880

Name: 11511
Annotation: K10133 TP53I3 tumor protein p53-inducible protein 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 TIGR02824: putative NAD(P)H quinone oxidoreductase, PIG3 family" amino acids 5 to 337 (333 residues), 331.3 bits, see alignment E=2.7e-103 PF00107: ADH_zinc_N" amino acids 156 to 285 (130 residues), 91 bits, see alignment E=9.6e-30 PF13602: ADH_zinc_N_2" amino acids 194 to 335 (142 residues), 55.6 bits, see alignment E=1.8e-18

Best Hits

Swiss-Prot: 43% identical to QORX_HUMAN: Quinone oxidoreductase PIG3 (TP53I3) from Homo sapiens

KEGG orthology group: None (inferred from 57% identity to uma:UM00131.1)

Predicted SEED Role

"Quinone oxidoreductase (EC 1.6.5.5)" in subsystem ZZ gjo need homes (EC 1.6.5.5)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.5

Use Curated BLAST to search for 1.6.5.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>mRNA_3143 K10133 TP53I3 tumor protein p53-inducible protein 3 (Rhodosporidium toruloides IFO0880)
MAQMRAVLIKNGKSDSAQDLYIGEAERPTLEQGDDRIIVKIKAFGANRMDIMQRRGMYPL
PPGASTILGVEFSGTVEEPGSSDFKKDEPVFGLATGGAYAEYISVPAGMCTRKPDHVSWE
QAAAVPENWLTAWQALFVISEMKEGSKVLIHAGASGVGLAAIQLAKAFGAGLVIATAGTD
DKISFVEQHGAKGINYKAQDFPTEVLKLTQDSGVDVLVDFIGASYWEKNLKSLARDGRMV
MLGLMGGAKTEGPTDLSQILYKRVRIEGTTLRSRSLEYQTNLLQEFSKKALDKVFARCNG
DEGLDLVIHKVYDWKDVAAAHEEMEQAKNIGKIILTIS