Protein Info for mRNA_3157 in Rhodosporidium toruloides IFO0880

Name: 11525
Annotation: K00942 E2.7.4.8, gmk guanylate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00625: Guanylate_kin
  • amino acids 9 to 190 (182 residues), 213.9 bits, E=7.6e-68
• TIGR03263: guanylate kinase
  • amino acids 10 to 191 (182 residues), 206.7 bits, E=1.1e-65

Best Hits

Swiss-Prot: 60% identical to KGUA_YEAST: Guanylate kinase (GUK1) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: K00942, guanylate kinase [EC: 2.7.4.8] (inferred from 59% identity to cci:CC1G_13164)

MetaCyc: 60% identical to guanylate kinase (Saccharomyces cerevisiae)
Guanylate kinase. [EC: 2.7.4.8]; T(2)-induced deoxynucleotide kinase. [EC: 2.7.4.8, 2.7.4.12, 2.7.4.13]

Predicted SEED Role

"Guanylate kinase (EC 2.7.4.8)" in subsystem MLST or Purine conversions (EC 2.7.4.8)

MetaCyc Pathways

• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of histidine, purine, and pyrimidine biosynthesis (38/46 steps found)
• superpathway of purine nucleotide salvage (14/14 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (21/26 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (15/18 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (8/9 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (7/9 steps found)
• dZTP biosynthesis (4/5 steps found)
• pyrimidine deoxyribonucleotide phosphorylation (3/4 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (5/7 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (10/14 steps found)
• purine deoxyribonucleosides salvage (4/6 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (5/8 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (4/7 steps found)
• superpathway of pyrimidine deoxyribonucleoside salvage (5/9 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.12 or 2.7.4.13 or 2.7.4.8

Protein Sequence (207 amino acids)

>mRNA_3157 K00942 E2.7.4.8, gmk guanylate kinase (Rhodosporidium toruloides IFO0880)
MSIAANLIRPVVICGPSGTGKSTLLKKLFVEFPDRFGFSVSHTTRAPRPGEENGTSYHFV
TREQFLDLVKADGFIEHAEFSGNMYGTSVKAVEDVKKGGKMCILDIDTQGVKLIKKNHPY
LNPLYVFISPPSLSSLKTRLTGRGTESEQSMSARLAAAVGELDYAKSGAFDVVVVNDDLE
RAYNVLKQVIIDGKTEAGDKLPHFEDK