Protein Info for mRNA_3191 in Rhodosporidium toruloides IFO0880

Name: 11559
Annotation: KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 529 transmembrane" amino acids 84 to 107 (24 residues), see Phobius details amino acids 126 to 144 (19 residues), see Phobius details amino acids 152 to 173 (22 residues), see Phobius details amino acids 179 to 199 (21 residues), see Phobius details amino acids 210 to 232 (23 residues), see Phobius details amino acids 244 to 262 (19 residues), see Phobius details amino acids 319 to 344 (26 residues), see Phobius details amino acids 355 to 378 (24 residues), see Phobius details amino acids 399 to 420 (22 residues), see Phobius details amino acids 432 to 452 (21 residues), see Phobius details amino acids 460 to 482 (23 residues), see Phobius details amino acids 494 to 516 (23 residues), see Phobius details PF07690: MFS_1" amino acids 90 to 473 (384 residues), 103.7 bits, see alignment E=5.3e-34

Best Hits

KEGG orthology group: None (inferred from 38% identity to ang:ANI_1_1448084)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (529 amino acids)

>mRNA_3191 KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) (Rhodosporidium toruloides IFO0880)
MQSLRLRRRLNTHYSLYIRDAPNAFGGRGKSEVTQPSGEGDGEGSASGPEAVKAGQDGQG
AFVVAFSTPSDPLNPQDWPLRTRLFTTFLLSLLVLFVGSASSMNAFVAKKAAADLGVSET
IADLDTALFLTGFGVAAPIMAPLSELAGRNPIYLISLLAVCLLEIGVAQTHTIWSRCVLR
FLAGCFATTPLSNAGAAMGDLWDREERSWTFPLFAVAGFFGPCLGPVISGWVAQSSLSYR
WTDWIQAAWAGLLFIVTFLLLPETYPPTLLGWKAAAIRECTRNPRYLTALEHKRQHIPYR
VDFVKTLARPFVMLVQEPIVLCFLAYLTLVYIVLFGSLVAYPLIFVPYDLSSGILGTSFL
SIAVGVVLCGACAPLMLWDYRRGIEQAWKQGFDEVEPEVRLRVAMVGTWAVPAGLAWNAW
VCYQSVSVFGSYGAQALFGFGILSCFISTYQYLIDSYGHAAASAMSATTFLRYPVAGSSV
LFTRPMYHRLDRHWALSLLAGLALVMSFIPFIFYLLGRRTRRWSRWTMH