Protein Info for mRNA_3221 in Rhodosporidium toruloides IFO0880

Name: 11589
Annotation: KOG2533 Permease of the major facilitator superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 71 to 92 (22 residues), see Phobius details amino acids 99 to 118 (20 residues), see Phobius details amino acids 125 to 150 (26 residues), see Phobius details amino acids 157 to 172 (16 residues), see Phobius details amino acids 175 to 196 (22 residues), see Phobius details amino acids 246 to 272 (27 residues), see Phobius details amino acids 281 to 301 (21 residues), see Phobius details amino acids 308 to 328 (21 residues), see Phobius details amino acids 335 to 355 (21 residues), see Phobius details amino acids 367 to 388 (22 residues), see Phobius details amino acids 402 to 423 (22 residues), see Phobius details PF07690: MFS_1" amino acids 35 to 384 (350 residues), 76.5 bits, see alignment E=9.6e-26

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (456 amino acids)

>mRNA_3221 KOG2533 Permease of the major facilitator superfamily (Rhodosporidium toruloides IFO0880)
MAMTKDFQDVSTEEEQRVLRKVNLALLPGLTFLDLLSFLDRSNVGTAKLLGLMKDIRLGA
ASKAPVYNTSLALYFLGYLGYVLFEIPANIVFKKFNPRVWLPTLTVAWGITATLQCLIKN
EAGFLAARFFMGVSEAGLFPGIVFVFSMYYKRNKRHWRVTVFFGGAALTGAFDSGWIFAI
EGIFTTLVGLTAYFWVPGYPRQAKFLNEREHAILIARLQADSDSADEEPLSWHGVWEAFK
DPLVLGYGFLFHAYAFTLYTLSLFLPTIIAQLGYTSWKVQLMTVPVYACAFSSMILSAWL
SHHFNQRGSFIIIAGAIAIVGYIVPLTTHTAGSRYAGAFIAVIGIYSANTLLLSWPSENV
SSQTKQAVASGMQIFIGDVGSIVSVLVYRPSLSTYFYRTPHGISILYTALGVIIAGALAF
SMSRANKSGNARRADRKEAKGEVALGERARGYLLQW