Protein Info for mRNA_3242 in Rhodosporidium toruloides IFO0880

Name: 11610
Annotation: K01814 hisA phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02129: phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase
  • amino acids 5 to 251 (247 residues), 399.2 bits, E=4.4e-124
• PF00977: His_biosynth
  • amino acids 7 to 233 (227 residues), 117.3 bits, E=3.9e-38

Best Hits

Swiss-Prot: 64% identical to HIS4_SCHPO: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (SPAC3F10.09) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K01814, phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase [EC: 5.3.1.16] (inferred from 70% identity to scm:SCHCODRAFT_12564)

MetaCyc: 48% identical to phosphoribosyl-formimino-5-aminoimidazole-4-carboxamide ribonucleotide isomerase (Arabidopsis thaliana col)
isomerase. [EC: 5.3.1.16]

Predicted SEED Role

"Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (EC 5.3.1.16)" in subsystem Histidine Biosynthesis (EC 5.3.1.16)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (38/46 steps found)
• L-histidine biosynthesis (9/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Histidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.16

Protein Sequence (256 amino acids)

>mRNA_3242 K01814 hisA phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (Rhodosporidium toruloides IFO0880)
MPSVFRPCIDLHNGAVKQIVGGSLDTDNLKTNFVSEHPSSYYADLYRKHNLTGGHVIKLG
PGNDMAAREALQAWPGGLQIGGGITEKNAQEWLDAGAEKIIVTSYLFPGARFDEERLRRL
AEKVGKERLVVDVSCRRRDDRWIVAMDRWQVMTDMEVNAGSLARLSQYCSEFLVHAADVE
GLCKGIDEELVAKLGEWTTIPTTYAGGAKSADDLALVERLSNGKVDLTFGSALDIFGGTQ
VKFDELVDYNKRALEV