Protein Info for mRNA_3261 in Rhodosporidium toruloides IFO0880

Name: 11629
Annotation: K00236 SDHC, SDH3 succinate dehydrogenase (ubiquinone) cytochrome b560 subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01127: Sdh_cyt
  • amino acids 50 to 168 (119 residues), 63.8 bits, E=8.1e-22
• TIGR02970: succinate dehydrogenase, cytochrome b556 subunit
  • amino acids 57 to 170 (114 residues), 56.3 bits, E=1.9e-19

Best Hits

KEGG orthology group: K00236, succinate dehydrogenase (ubiquinone) cytochrome b subunit [EC: 1.3.5.1] (inferred from 47% identity to cci:CC1G_06197)

Predicted SEED Role

"Succinate dehydrogenase cytochrome b560 subunit, mitochondrial precursor"

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (20/22 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/25 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (13/14 steps found)
• TCA cycle III (animals) (10/10 steps found)
• TCA cycle II (plants and fungi) (9/9 steps found)
• superpathway of glyoxylate bypass and TCA (11/12 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• TCA cycle VIII (Chlamydia) (6/6 steps found)
• TCA cycle V (2-oxoglutarate synthase) (8/9 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (7/9 steps found)
• partial TCA cycle (obligate autotrophs) (6/8 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
• succinate to cytochrome bd oxidase electron transfer (1/2 steps found)
• succinate to cytochrome bo oxidase electron transfer (1/2 steps found)
• succinate to plastoquinol oxidase (1/2 steps found)
• TCA cycle VII (acetate-producers) (6/9 steps found)
• aerobic respiration II (cytochrome c) (yeast) (2/4 steps found)
• succinate to chytochrome c oxidase via cytochrome c₆ (1/3 steps found)
• succinate to cytochrome c oxidase via plastocyanin (1/3 steps found)
• methylaspartate cycle (9/19 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.3.5.1

Use Curated BLAST to search for 1.3.5.1

Protein Sequence (172 amino acids)

>mRNA_3261 K00236 SDHC, SDH3 succinate dehydrogenase (ubiquinone) cytochrome b560 subunit (Rhodosporidium toruloides IFO0880)
MQALARQSLTNQALRRTFARPAALVPARFISTQPMSKEEALEYLNQQRAKRASSPWHIYQ
PQLTSISSIANRVTGTGLSVAFYGIFLSHVIAPVFGASVDSAALIDAWTALPSFLQLTTK
TAIVGATTYHTFNGLRHLSWDMGYLLNLKTSYMAGYAVLGATAVSTAAILAM