Protein Info for mRNA_3277 in Rhodosporidium toruloides IFO0880

Name: 11645
Annotation: K14835 NOP2 ribosomal RNA methyltransferase Nop2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 705 PF17125: Methyltr_RsmF_N" amino acids 325 to 410 (86 residues), 31.3 bits, see alignment E=2.4e-11 TIGR00446: NOL1/NOP2/sun family putative RNA methylase" amino acids 347 to 622 (276 residues), 322.7 bits, see alignment E=8.1e-101 PF01189: Methyltr_RsmB-F" amino acids 414 to 622 (209 residues), 232 bits, see alignment E=5.4e-73

Best Hits

Predicted SEED Role

"tRNA/RNA cytosine-C5-methylase (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (705 amino acids)

>mRNA_3277 K14835 NOP2 ribosomal RNA methyltransferase Nop2 (Rhodosporidium toruloides IFO0880)
MGRQARTKQADPLPFAGGGKAHPGAPERKGKRKLVAEAKGERAQGPRATKRAKKVSEGGA
EVKGKGKAKAGKGKAKADQKKKVTDGVEWESDDDDIEGMKAEDGWTDEEDEMSDAEANGL
EKARSALFDDVDLEEPGAGGDEYDDEFDLDRADDDDEEDLDDEFDLDDEEVDGVTEEDEN
DALAQQGLSKKRAARAAAYNSEDSDDSEDDLPLPAGLNPARPDPEPIAGQVDATMEELEA
ARSDDEGEEEDSDDEAGGMSRLQNGKLEDLRQVEKRMRTAARVLAHWKELGAQAGMSRSD
LREQLISDICQYHGYTPFLAEKLFEVFGPEEALEFFAASDTPRPLTIRVNTLKTRRRDLA
QALINRGVNLQPLEGGWSKVGLQVFSGSSVPIGATPEYLAGHYILQAASSFLPVMALDPQ
PHERCLDMSAAPGGKTTYMSALMGNTGEVWANDSSRGRIKGLGGNVARLGCRNVVITNVD
GREFPKIMGGFDRVLLDAPCSGTGVISKDPSVKVNKTERDFMLLSHLQKQLLLCAIDSVS
PNSEKGGYVCYSTCSVTVEENEAVVSYALRKRPHVKLVDTGLPFGKPGFKSYKGKEFGKG
IELTRRFYPHVANVDGFFVSVFKVGKPQKQIPEPASPTLPFEPLLLNEKDEQDAAEAKED
APAFDDAEDAKLIEESRRKIAKRKGLNPKADKSKAGKKARVEKDE