Protein Info for mRNA_3281 in Rhodosporidium toruloides IFO0880

Name: 11649
Annotation: KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 583 transmembrane" amino acids 74 to 97 (24 residues), see Phobius details amino acids 107 to 130 (24 residues), see Phobius details amino acids 142 to 161 (20 residues), see Phobius details amino acids 199 to 221 (23 residues), see Phobius details amino acids 230 to 250 (21 residues), see Phobius details amino acids 307 to 333 (27 residues), see Phobius details amino acids 345 to 364 (20 residues), see Phobius details amino acids 386 to 406 (21 residues), see Phobius details amino acids 412 to 434 (23 residues), see Phobius details amino acids 443 to 468 (26 residues), see Phobius details amino acids 480 to 502 (23 residues), see Phobius details PF07690: MFS_1" amino acids 81 to 466 (386 residues), 135.3 bits, see alignment E=4.1e-43 PF00083: Sugar_tr" amino acids 108 to 498 (391 residues), 34 bits, see alignment E=2.5e-12 PF06609: TRI12" amino acids 117 to 240 (124 residues), 30.9 bits, see alignment E=1.6e-11

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (583 amino acids)

>mRNA_3281 KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) (Rhodosporidium toruloides IFO0880)
MPAEFSPTSTLHGSPTGGNKLDLHPSPHETHDGLDAATAPVPYDGQGTEESPYIVKWLDG
EEENPQNWSGTKKWLITANAAVSTLCIAFGSSIYAGGLGDFLVYFKTSVTIITLGLSLYV
LGFALGPLLWAPFSEQWGRRPVFLVTYFLFAVFNIPCALAKNIETLLICRFLAGFFGSSP
LTNSGGVISDMFSASERALGISIFALAPFAGPVLGPIIGGFLGQNASWRWLFWLLTIFAF
VMWGLGFLSPETYAPVLLRKRAAKLSAETGKVYRSMYDLHPMFSAPFSEKMKAALLRPFV
LLFKEMIILLFSIYAAFIYGILYLFFGAFTIIYQQERGWSPGVGGLPFISVGLGMVLAVV
ANVYDNKRYVRKLVAGGGVPLAPESRLPLCCIGGVVLPIGLFAFAWSTLPQVHWIASVIF
AFPFGFGMVAVFLSMMSFLVDAYLLLAASALAANAVIRSLFGFAFPLFTHDMFEGMGTQW
ALTLIAFVALALAPIPFVFYVYGARIRQNSSFAPGHKPAAPAPAKTEEKADDQLERQTTR
LSTRQEIEAEEVAMMDLRQAESITEEQALERRKGMQHAVDSQA