Protein Info for mRNA_3307 in Rhodosporidium toruloides IFO0880

Name: 11675
Annotation: K06268 PPP3R, CNB serine/threonine-protein phosphatase 2B regulatory subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 175 PF13499: EF-hand_7" amino acids 24 to 80 (57 residues), 34.2 bits, see alignment E=8.7e-12 amino acids 92 to 160 (69 residues), 49.7 bits, see alignment E=1.3e-16 PF13405: EF-hand_6" amino acids 25 to 49 (25 residues), 25 bits, see alignment 3.7e-09 PF00036: EF-hand_1" amino acids 26 to 49 (24 residues), 26.2 bits, see alignment (E = 1.2e-09) amino acids 136 to 162 (27 residues), 32.4 bits, see alignment 1.2e-11 PF13202: EF-hand_5" amino acids 26 to 48 (23 residues), 23.9 bits, see alignment (E = 6.4e-09) amino acids 98 to 115 (18 residues), 17.6 bits, see alignment (E = 6.4e-07) amino acids 137 to 160 (24 residues), 25.5 bits, see alignment (E = 2.1e-09) PF13833: EF-hand_8" amino acids 30 to 48 (19 residues), 14 bits, see alignment (E = 1.1e-05) amino acids 108 to 161 (54 residues), 23 bits, see alignment E=1.7e-08

Best Hits

Swiss-Prot: 82% identical to CANB_CRYNJ: Calcineurin subunit B (CNB1) from Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)

KEGG orthology group: K06268, protein phosphatase 3, regulatory subunit (inferred from 83% identity to cci:CC1G_08194)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (175 amino acids)

>mRNA_3307 K06268 PPP3R, CNB serine/threonine-protein phosphatase 2B regulatory subunit (Rhodosporidium toruloides IFO0880)
MGAGQSQILEDMEKNTNFSAAEIQRLKKRFMKLDKDGSGSIDKDEFLQIPQIATNPLASR
MIAIFDEDGGGTVDFQEFVAGLSAFSNRGGRDEKLKFAFKVYDMDRDGFISNGELFLVLK
MMVGNNLKDQQLQQIVDKTMMEADQDGDGKLSFDEFKEMVASTDIAKQMTLEDMW