Protein Info for mRNA_3308 in Rhodosporidium toruloides IFO0880

Name: 11676
Annotation: KOG2533 Permease of the major facilitator superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 transmembrane" amino acids 38 to 61 (24 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 130 to 155 (26 residues), see Phobius details amino acids 162 to 184 (23 residues), see Phobius details amino acids 196 to 218 (23 residues), see Phobius details amino acids 266 to 289 (24 residues), see Phobius details amino acids 301 to 323 (23 residues), see Phobius details amino acids 331 to 349 (19 residues), see Phobius details amino acids 359 to 379 (21 residues), see Phobius details amino acids 391 to 411 (21 residues), see Phobius details amino acids 418 to 439 (22 residues), see Phobius details PF07690: MFS_1" amino acids 43 to 407 (365 residues), 98.4 bits, see alignment E=2.2e-32

Best Hits

KEGG orthology group: None (inferred from 44% identity to ang:ANI_1_2096094)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (484 amino acids)

>mRNA_3308 KOG2533 Permease of the major facilitator superfamily (Rhodosporidium toruloides IFO0880)
MSSADEKSLPGDADVKLAPLEIDAAVERRVVRKLDMTVLIAFAMVFGINYLDKIGLSYAA
IFGMKKDLALVKQDYSWTASIFYFGQAASEFVCLYLLHKLPIRSFVAVSIVVWAIVVACQ
AATKNFTDMMIVRFFLGFTEGAVAPAFVLMTSFFYRKREQPIRIAVFVSFNALAQIVGAL
LLYGCGSIKGGALKGWRISFLICAALTILIGIYFFIFVPKSPGQAWFLTPEEREVAVARV
AQERASLAHSNVDWRQIRQTLLDIRFYLVFLWAFFVCITSVVTFGSIVINGFGFTPFKTL
LVGLPGPAIQLLTIWIGAGALYFMPNARGWTQMALTLIPLTGVALMRGLPYHTKWGLTAG
YWLATCNSSVYVVNMSLIASNTKGHTRKTMFSLVYFLGYCVGCIAGPQLFLSYEAPLYRT
AMNTIIGMYCAYLASMFLYREICRRENNRRDKLAAEGVEEAKPRLATHESNDTDIDDLAF
RFVL