Protein Info for mRNA_3314 in Rhodosporidium toruloides IFO0880

Name: 11682
Annotation: K00030 IDH3 isocitrate dehydrogenase (NAD+)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 TIGR00175: isocitrate dehydrogenase, NAD-dependent" amino acids 38 to 371 (334 residues), 516.7 bits, see alignment E=1.3e-159 PF00180: Iso_dh" amino acids 43 to 368 (326 residues), 270.5 bits, see alignment E=1.2e-84

Best Hits

Swiss-Prot: 65% identical to IDH1_AJECA: Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial (IDH1) from Ajellomyces capsulatus

KEGG orthology group: K00030, isocitrate dehydrogenase (NAD+) [EC: 1.1.1.41] (inferred from 74% identity to scm:SCHCODRAFT_80265)

Predicted SEED Role

"Isocitrate dehydrogenase [NAD] subunit I, mitochondrial precursor (EC 1.1.1.41)" (EC 1.1.1.41)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.41

Use Curated BLAST to search for 1.1.1.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (373 amino acids)

>mRNA_3314 K00030 IDH3 isocitrate dehydrogenase (NAD+) (Rhodosporidium toruloides IFO0880)
MFPKPLALRNQLIGQARSATTLGVGISRPSAIQPTKYGGVYSVTLIPGDGVGKEITQSVE
EIFEHANVPVEFEKFNVSGGTSEDAALFKRSMDSLRRNKVGLKGILYTPVERSGHTSWNV
AMRQQLDIYASVVLCKSVPGVPTRHKDVDFAIIRENTEGEYSGLEHQSSPGVVESLKIMT
RHKTERIARFAFDFAIKNGRKHVTAIHKANIMKLGDGLFLNTCRRVAEEYKDSGITFSDM
IVDNTSMQLVNRPQQFDVMVMPNLYGSIISNIGAALVGGPGIVPGANIGREFALFEPGCR
HVAKDIQGQDSANPAAMILSATMLLRHLGCDHHANAIASSVYKILEEGKIRTPDLGGTSH
TTDFTHAVIKGLQ