Protein Info for mRNA_3318 in Rhodosporidium toruloides IFO0880

Name: 11686
Annotation: K14640 SLC20A, PIT solute carrier family 20 (sodium-dependent phosphate transporter)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 585 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 47 to 65 (19 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details amino acids 114 to 132 (19 residues), see Phobius details amino acids 145 to 170 (26 residues), see Phobius details amino acids 182 to 205 (24 residues), see Phobius details amino acids 220 to 241 (22 residues), see Phobius details amino acids 464 to 486 (23 residues), see Phobius details amino acids 508 to 538 (31 residues), see Phobius details amino acids 551 to 577 (27 residues), see Phobius details PF01384: PHO4" amino acids 24 to 568 (545 residues), 361.2 bits, see alignment E=2.6e-112

Best Hits

KEGG orthology group: K14640, solute carrier family 20 (sodium-dependent phosphate transporter) (inferred from 63% identity to cci:CC1G_09076)

Predicted SEED Role

"solute carrier family 20 (phosphate transporter), member 1; Probable low-affinity inorganic phosphate transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (585 amino acids)

>mRNA_3318 K14640 SLC20A, PIT solute carrier family 20 (sodium-dependent phosphate transporter) (Rhodosporidium toruloides IFO0880)
MPMHQYDYLFAIGTLFAVLDAFNIGANDAANSWATSVASKSLSMKQAVLGAAVMEFVGAV
SVGSRTADTIKSGIIQSAAFRGDPGIQLLAFTCAIVASGSWLMVCTRMGWPVSTTYSIVS
AVAGVGVALGGADSVEWGWNGGKGLATIFAGFGIAPAIAGGFGAVVYLLVKFGVLARRNP
FPWALASGPMVFFTCAAVMTLSIIYKGAPSLGLKSLSSSGVAAATVGSAAVVALLAVLFW
VPYVHARVAKKDYTIRFYHFFLGPLLWFRKPPADAEERLSSVPDYRMRADREGETHGNVR
QPVQDAESGSPSESYEDKDKIIEGEDTTVPRTHESTLQKEVERADPHPIEGAWAEPKNLW
IILRYKSFPFIKKVLTHGTSYDIHAAQAGLAGTPEHRRMAQVYERAKQYPNETEACYSFV
QVLTACVNSFAHGANDLGNAVGPFAVIYHTWSTATLSGKKTDVPVWILVAGACFLVLGLA
TYGYNIMRVLGNKITLHSPSRGFSMELGSAITVVLASQYGLPVSTTMCITGSTVGVALCN
GDFRAVNWRAVGWIFLGWVITVPIVGTLAGCLMGIVLNAPHFPSQ