Protein Info for mRNA_3332 in Rhodosporidium toruloides IFO0880

Name: 11700
Annotation: K17424 MRPL43 large subunit ribosomal protein L43

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 146 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF05047: L51_S25_CI-B8" amino acids 46 to 97 (52 residues), 48.1 bits, see alignment E=4.5e-17

Best Hits

Swiss-Prot: 41% identical to RM51_ASHGO: 54S ribosomal protein L51, mitochondrial (MRPL51) from Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)

KEGG orthology group: None (inferred from 53% identity to ncr:NCU07549)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (146 amino acids)

>mRNA_3332 K17424 MRPL43 large subunit ribosomal protein L43 (Rhodosporidium toruloides IFO0880)
MPPRILRSSLSAPLPSTAPSSRSAFILPCKKLVVQYSETQGSNRGMRDFIGQGLPVDIAR
RYPGVEVVVERREAKHPILRGVYNNGRTKEICVRNLPPLSILSKAQLLLDSSGQKIVSIK
RPGVVSTTESVRGVWSAFHDEVRQAA