Protein Info for mRNA_3333 in Rhodosporidium toruloides IFO0880

Name: 11701
Annotation: K05283 PIGW phosphatidylinositol glycan, class W

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 521 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 79 to 102 (24 residues), see Phobius details amino acids 131 to 151 (21 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details amino acids 211 to 230 (20 residues), see Phobius details amino acids 243 to 263 (21 residues), see Phobius details amino acids 271 to 289 (19 residues), see Phobius details amino acids 309 to 330 (22 residues), see Phobius details amino acids 372 to 390 (19 residues), see Phobius details amino acids 410 to 434 (25 residues), see Phobius details amino acids 467 to 488 (22 residues), see Phobius details amino acids 494 to 513 (20 residues), see Phobius details PF06423: GWT1" amino acids 304 to 482 (179 residues), 137 bits, see alignment E=3e-44

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (521 amino acids)

>mRNA_3333 K05283 PIGW phosphatidylinositol glycan, class W (Rhodosporidium toruloides IFO0880)
MGYKEDKVAFVSHATGGSVTHINLVCATALTTYALWTVAQRRTLSKLPSSSLKTPVLEFL
ILVLPLLLALTLFSARPLLLNAILILSTLAWHLQPAPLGSPPLSPKLEKSRRHSRMPSQI
DLKPFSRPFVTIYRAIMMVMTVLCILAVDFPVFPREFAKAETWGTSLMDLGVGSFVFSLG
LVSALPLLRSHSSTPSAHTRRSYISSVFRSTRKCLPLVALGMVRVVMVKGVDYPEHLTEY
GVHWNFFFTLALLPVFGSALEGLAGKVDMHVVGLAVGIVHQLALSWTPLQHWALEAPRTT
IISQNKEGIVSFPGYLSIYLLGLATGLYTLPPSPTFFSLHTRSPPAHSTAAEKREWERKR
EKSGTFSKPGKLAEWIGSAAVCWWGVYWVVEWVVKGEEGAGGVSRRLANLPYVLWTVAFN
TSFIFAYLMIHLAVASSSSSSTPSSSSAASNLASKSPAIFHALNQNGLVVFLVANLLTGL
INVLLPTMYMRDSLAVIVLVGYAAVVVGVAWALRGRRVKVS