Protein Info for mRNA_3334 in Rhodosporidium toruloides IFO0880

Name: 11702
Annotation: K03936 NDUFS3 NADH dehydrogenase (ubiquinone) Fe-S protein 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF00329: Complex1_30kDa" amino acids 99 to 220 (122 residues), 164.2 bits, see alignment E=9.9e-53 TIGR01961: NADH (or F420H2) dehydrogenase, subunit C" amino acids 101 to 219 (119 residues), 155.4 bits, see alignment E=4.8e-50

Best Hits

Swiss-Prot: 50% identical to NDUS3_PONPY: NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial (NDUFS3) from Pongo pygmaeus

KEGG orthology group: K03936, NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC: 1.6.5.3 1.6.99.3] (inferred from 62% identity to cne:CNF03360)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain C (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3, 1.6.99.3

Use Curated BLAST to search for 1.6.5.3 or 1.6.99.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (289 amino acids)

>mRNA_3334 K03936 NDUFS3 NADH dehydrogenase (ubiquinone) Fe-S protein 3 (Rhodosporidium toruloides IFO0880)
MAAPRVATRLLSAASRASSRPACAAARSCAAAARPIATSAIRSQIPTGKESPYVEPAGRN
PVEHFQPYSAQLQEYGAWIMASLPKFIQQTSVYKDELTLYVAPSAIVPVMYFLRDHTNTQ
FKQVMDICGADYPTRGKRFEVVYHLLSVRHQSRIRVKTYADETSPVPSIVKIFRGADWYE
REAWDMYGIYFTGHPDLRRILTDYGFEGHPLRKDFPLTGYTEVRYDEEKKRVVSEPLQLS
QAFRNFEGATSPWEGTGTGIDARAPQFVLQPPKDEGKANEEKKSEATKK