Protein Info for mRNA_3336 in Rhodosporidium toruloides IFO0880

Name: 11704
Annotation: K07827 KRAS, KRAS2 GTPase KRas

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 TIGR00231: small GTP-binding protein domain" amino acids 1 to 157 (157 residues), 115.3 bits, see alignment E=1.2e-37 PF00025: Arf" amino acids 3 to 155 (153 residues), 35.5 bits, see alignment E=1.5e-12 PF00071: Ras" amino acids 5 to 165 (161 residues), 176.3 bits, see alignment E=7.4e-56 PF08477: Roc" amino acids 5 to 119 (115 residues), 74.3 bits, see alignment E=2e-24 PF00009: GTP_EFTU" amino acids 39 to 128 (90 residues), 33.2 bits, see alignment E=7.7e-12

Best Hits

Swiss-Prot: 53% identical to RASD_DICDI: Ras-like protein rasD (rasD) from Dictyostelium discoideum

KEGG orthology group: K07974, Ras family, other (inferred from 62% identity to uma:UM01643.1)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (188 amino acids)

>mRNA_3336 K07827 KRAS, KRAS2 GTPase KRas (Rhodosporidium toruloides IFO0880)
MNTVKLVMLGEGGVGKTAISLRVAMNYFVETYDPTIEDSYRTTANIDGQTYLLEILDTAG
QEEYTALRDQWIREGEGFLVVYSTTSRASFDSVEKFCRQIARVKDSNRVPIVLVGNKIDR
VHEREVETRHGEELARRLGCGFVETSAKTRENLEEVYCTAVRMIEQQRGGSTANPVKKKK
KPRKCSIL