Protein Info for mRNA_3373 in Rhodosporidium toruloides IFO0880

Name: 11741
Annotation: K00390 cysH phosphoadenosine phosphosulfate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02057: phosphoadenosine phosphosulfate reductase
  • amino acids 19 to 248 (230 residues), 265.4 bits, E=5.1e-83
• TIGR00434: phosophoadenylyl-sulfate reductase
  • amino acids 31 to 249 (219 residues), 231.7 bits, E=9e-73
• PF01507: PAPS_reduct
  • amino acids 46 to 223 (178 residues), 137.4 bits, E=2.7e-44

Best Hits

KEGG orthology group: K00390, phosphoadenosine phosphosulfate reductase [EC: 1.8.4.8] (inferred from 61% identity to cne:CNB03860)

Predicted SEED Role

"Phosphoadenylyl-sulfate reductase [thioredoxin] (EC 1.8.4.8)" in subsystem Cysteine Biosynthesis (EC 1.8.4.8)

MetaCyc Pathways

• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (9/10 steps found)
• assimilatory sulfate reduction I (4/4 steps found)
• assimilatory sulfate reduction III (3/3 steps found)
• superpathway of sulfate assimilation and cysteine biosynthesis (7/9 steps found)
• assimilatory sulfate reduction IV (3/4 steps found)

KEGG Metabolic Maps

• Sulfur metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.8

Protein Sequence (308 amino acids)

>mRNA_3373 K00390 cysH phosphoadenosine phosphosulfate reductase (Rhodosporidium toruloides IFO0880)
MPSSPVASTSSIPFDPARLDEINASLADASPQDVLTYAIDFIPGLFQTTAFGLTGLAATD
MISRISRKRKQPHAVPLIFLDTLYHFPETLDLARRVEKKYQLELQTFRPPGVETVEEFEK
KYGEKLWETDEDTYDYLVKVEPARRAYDTLGVKAVITGRRRSQGADRATLEPIEIDSTGL
VKVNPLCRWGFQEVKDYIDMAGVPYNPLLDQGYKSVGDWHSTVKPKDGEGERSGRWASNK
TKTECGLHKDYFAMKRAFEKKQLEQARAAADKARGDEEVGESSVDLSQETDATSQDLGAS
FSDLKLGA