Protein Info for mRNA_3389 in Rhodosporidium toruloides IFO0880

Name: 11757
Annotation: K00521 E1.16.1.7 ferric-chelate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 596 transmembrane" amino acids 66 to 87 (22 residues), see Phobius details amino acids 127 to 150 (24 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 203 to 221 (19 residues), see Phobius details amino acids 241 to 261 (21 residues), see Phobius details amino acids 268 to 288 (21 residues), see Phobius details amino acids 295 to 319 (25 residues), see Phobius details amino acids 405 to 423 (19 residues), see Phobius details PF01794: Ferric_reduct" amino acids 168 to 283 (116 residues), 52.9 bits, see alignment E=6.1e-18 PF08022: FAD_binding_8" amino acids 329 to 406 (78 residues), 32.8 bits, see alignment E=9.7e-12 PF08030: NAD_binding_6" amino acids 406 to 559 (154 residues), 42.9 bits, see alignment E=8.9e-15

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (596 amino acids)

>mRNA_3389 K00521 E1.16.1.7 ferric-chelate reductase (Rhodosporidium toruloides IFO0880)
MMDMHSVAANFTGIDACYLGDHNGSWPNGTLGAGTWTEFGRYSPTGGEMMACQAGNDPWS
ASYKYGLWTTYFFLALFIAAGIYNAFLSLDTLNRNAALLSPFAIPARVKAVVRSLDQRKI
SGFVPEVGVVLLAAVFAVFSLAVCFGIRPYYRPPNFGSSPLGLRSEWIATALIVWIIATA
TKRNPLSYLSGIPFHRLMSLHKLLPWFCLFFALVHTVAMIVRANKPQPWRVTLATNSAYG
WSAWTALASLAFLCLASLPPVRRLSHEFFYPSHIFAAILMLAACYDHFEGLLGSWSYLHA
AVVLLGVAVVHRFAAVAFVSRFFTRPETASVEVGGDGVLVVKVVVRNAEMKWSAGQHVFV
RFLTLHPWSTHPFTIASLDASATSFSPSDPLKRQMKFLIRPHSGLTARGTGISFVLPLLL
ALVEGTEVHAVKDVRLVWAVRSAECVEWVREELERVVRLVKDDTEERGKEGRGWMGVEKL
EVEVFVTRSETPQLGGSKASSSDDLGGIQEVAASPSPLVLQSGRPDIAKTVDTATRTSHR
LAVVACGPSSLLHETRNAVARAQLAIALHGKVKSAGEGKSEDGVEEIVYWEEKYAL