Protein Info for mRNA_3408 in Rhodosporidium toruloides IFO0880

Name: 11776
Annotation: K00012 UGDH, ugd UDPglucose 6-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03026: nucleotide sugar dehydrogenase
  • amino acids 11 to 450 (440 residues), 324.5 bits, E=4.6e-101
• PF03721: UDPG_MGDP_dh_N
  • amino acids 12 to 194 (183 residues), 202.7 bits, E=6.5e-64
• PF00984: UDPG_MGDP_dh
  • amino acids 220 to 314 (95 residues), 103.2 bits, E=1.1e-33
• PF03720: UDPG_MGDP_dh_C
  • amino acids 338 to 453 (116 residues), 116.3 bits, E=1.2e-37

Best Hits

Swiss-Prot: 63% identical to UGDH_HUMAN: UDP-glucose 6-dehydrogenase (UGDH) from Homo sapiens

KEGG orthology group: K00012, UDPglucose 6-dehydrogenase [EC: 1.1.1.22] (inferred from 74% identity to scm:SCHCODRAFT_82564)

MetaCyc: 63% identical to UDP-glucose dehydrogenase (Mus musculus)
UDP-glucose 6-dehydrogenase. [EC: 1.1.1.22]

Predicted SEED Role

"UDP-glucose dehydrogenase (EC 1.1.1.22)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) or Teichuronic acid biosynthesis (EC 1.1.1.22)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (11/11 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (5/6 steps found)
• UDP-α-D-glucuronate biosynthesis (from UDP-glucose) (1/1 steps found)
• UDP-α-D-xylose biosynthesis (1/2 steps found)
• UDP-sugars interconversion (2/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Nucleotide sugars metabolism
• Pentose and glucuronate interconversions
• Starch and sucrose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.22

Protein Sequence (473 amino acids)

>mRNA_3408 K00012 UGDH, ugd UDPglucose 6-dehydrogenase (Rhodosporidium toruloides IFO0880)
MASQITPVQVKKIACIGAGYVGGPTCSMIAHKCPHIQVTIVDVNADRINAWNSDTLPIYE
PGLEEIVKACRGKNLFFDTDIDKAIVEADLIFVSVNTPTKKSGVGAGYAADLFYVELCTR
RIASVATSSKIVVEKSTVPCRTAQSMRTILEANSRPGLRFDILSNPEFLAEGTAINDLAH
PDRVLIGSLGTPEGRAAQASLVDVYANWVPREKCITTGLWSSELTKLAANAILAQRISSI
NALSAICEVTGADVDEVAYACGLDSRIGPKFLKSSVGFGGSCFQKDILNLVYLSESLHLP
EVADYWRQVITMNEYQKRRFAQTVVSSMFNTITNKKLAVLGFAFKKDTGDTRETPSATVC
RFFRQESAKISVYDPKVPEKQIFLDLTEPGVVDDSEQVKKQVTVCKSAMEACTGAEGICV
LTEWDEFKTLDWSAIYASMAKPAMVFDGRGILDADKLREIGFKVFSIGKGVNL