Protein Info for mRNA_3431 in Rhodosporidium toruloides IFO0880

Name: 11799
Annotation: K11155 DGAT1 diacylglycerol O-acyltransferase 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 678 transmembrane" amino acids 162 to 182 (21 residues), see Phobius details amino acids 202 to 223 (22 residues), see Phobius details amino acids 235 to 257 (23 residues), see Phobius details amino acids 263 to 286 (24 residues), see Phobius details amino acids 490 to 510 (21 residues), see Phobius details amino acids 519 to 541 (23 residues), see Phobius details amino acids 601 to 622 (22 residues), see Phobius details amino acids 628 to 646 (19 residues), see Phobius details amino acids 658 to 676 (19 residues), see Phobius details PF03062: MBOAT" amino acids 464 to 676 (213 residues), 128.5 bits, see alignment E=2.1e-41

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (678 amino acids)

>mRNA_3431 K11155 DGAT1 diacylglycerol O-acyltransferase 1 (Rhodosporidium toruloides IFO0880)
MASLDPPLPGPANLVDDALRHPDSAPPIPPDSAPPSHPSTATQPSATSRGQLSTASSYAS
DVSTRDGTPDLANGQGVTTTITTVTGKGGKAVTQTLTHVGASSVDARFSSSTSSITLRPI
PARGGDPKKIKVLRSRRTHFAPRTSHFDRHNLTSASDPFRGLYTLFWIVIFVGALKTVYH
RFAEQGGWGGEWRFAALISRDGWVLAVSDAVLVSASLLCVPYAKLLVHGWIRYHGAGVII
QHICQTLYLAIAIRWTFHRNWPWVQSGFMTLHALSMLMKIHSYCSLNGELSERRRQLRKD
EGRLEEVLEEMGGRRRAEREAREEWERQCGEAARAKEGEAGSREGKKEEVAAQSSTDAST
SALSSEDEAAAALLRHRQSTARRRSISPSASRTHSSSASSSHPAPSRAEEPQEGVETLTW
HPSDRVSKLAIAICEAKDLLTSNGKKPVTFPENVTFANFIDYLLVPTLVYELEYPRTDSI
RPLYILEKTLATFGTFSILVLIVDSFILPVTSRTDTPLFGFVLDLALPFTLAYLLIFYVI
FEGVCNGFAELTRFADRNFFDDWWNSCTFDEFSRKWNRPVHAFLLRHVYAETMASYKLSK
LSAAFVTFLFSACVHELVMAVVTKKLRLYLFSMQMAQLPLIMVGRAKIFRKYPALGNLFF
WLALLSGFPLLGTLYLRY