Protein Info for mRNA_3436 in Rhodosporidium toruloides IFO0880

Name: 11804
Annotation: HMMPfam-Oligosaccharyltransferase subunit Ribophorin II-PF05817

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 583 transmembrane" amino acids 205 to 228 (24 residues), see Phobius details amino acids 248 to 269 (22 residues), see Phobius details amino acids 396 to 421 (26 residues), see Phobius details amino acids 450 to 471 (22 residues), see Phobius details amino acids 476 to 493 (18 residues), see Phobius details PF05817: Ribophorin_II" amino acids 372 to 500 (129 residues), 41.1 bits, see alignment E=4.7e-15

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (583 amino acids)

>mRNA_3436 HMMPfam-Oligosaccharyltransferase subunit Ribophorin II-PF05817 (Rhodosporidium toruloides IFO0880)
MDDRIPLPADTNVVPPRYRPIISREWASDYPTYYAEFEEIYWMFDGWDALADELYADWLL
YMAEAKRVRAEIEEMWKGKKTFAEAARQAAHETWLYEENKRLYDLGGKLKERLEGPGASL
NTGSRESPERVALAQRQIAAFDCFSISHVLSIASTQYSYRGVPSPCRMTFDGPASLTALS
LHFFLPAIEAPCASPPSLPHMMASFGRLCFALTSSARFVVSFLVAASLRKVDLPLLTRYF
ASHRSRMARWLASTALLAAAASSLARAAIVVRDGKLSLIDAVGASAVATTAFTSDSPSPL
PARQLSPTDALKLSFTVLNDSAPFAPQQAAVLVQPVNEEERKQPGRDWTSWVKVRQNSGK
ARWDLDLPKHWEVERYKPMPEIQWTFREGEKKVNKVLALGGTAVVLAPWLVLLVAVGSGA
LSSSTHTKLTSPLPRQLRYILPSLHLSSSPLIHTFLASLTALELLFIVYWVQLRLIPTLP
IFLGLGAWNAWIGRRALGEVRRRRIAREEKEAGKKVEGLKLSSPPCLPWSPLYGLCSSLS
LTLAETRHAVNITFLQGKIDHDPPAPPGKGGRQKRATAAKPAS