Protein Info for mRNA_3446 in Rhodosporidium toruloides IFO0880

Name: 11814
Annotation: K07393 ECM4 putative glutathione S-transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13409: GST_N_2
  • amino acids 63 to 179 (117 residues), 76.3 bits, E=3.7e-25
• PF00043: GST_C
  • amino acids 224 to 303 (80 residues), 31.4 bits, E=3.6e-11
• PF14497: GST_C_3
  • amino acids 225 to 302 (78 residues), 25.2 bits, E=3.2e-09
• PF13410: GST_C_2
  • amino acids 228 to 301 (74 residues), 59.2 bits, E=6.9e-20

Predicted SEED Role

"Glutathione S-transferase, omega (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

• 4-hydroxy-2-nonenal detoxification (1/4 steps found)
• pentachlorophenol degradation (5/10 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• gliotoxin biosynthesis (1/9 steps found)
• glutathione-mediated detoxification II (1/9 steps found)
• indole glucosinolate activation (intact plant cell) (3/12 steps found)
• camalexin biosynthesis (2/12 steps found)

KEGG Metabolic Maps

• Drug metabolism - cytochrome P450
• Glutathione metabolism
• Metabolism of xenobiotics by cytochrome P450

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Protein Sequence (346 amino acids)

>mRNA_3446 K07393 ECM4 putative glutathione S-transferase (Rhodosporidium toruloides IFO0880)
MSGEHGAHEGESKAAAGSKQDITAWASKDGQFRRQASTFRDKIEVGGKYPPEEGRYVLYV
SLACPWAHRTLIVRKLKGLEKFIDVAVVHAHMGALGWSFYPPVRDQDGGYPKTQGEVGEP
DGLAEVTGDPLYKSKFLRELYFRVDPNYSGRFTVPVLWDKKTESIVNNESSEIIRFMNSE
FDSLLDEEHVKLDLYPEALRSEIDDQNKWVYDTVNNGVYKSGFATTQQAYEDNVVPLFKS
LDRLEKMLEGKQFIAGDQLTEADVRLYTTIIRFDPVYYNHFKTNIGTIRHRYPNLNAWQK
RLYWQNDAFKSTTNFDHIKRHYFESHPQINPTRVVPVGPQPHIEHL