Protein Info for mRNA_3448 in Rhodosporidium toruloides IFO0880

Name: 11816
Annotation: HMMPfam-Peptidase M50B-like-PF13398

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 transmembrane" amino acids 40 to 60 (21 residues), see Phobius details amino acids 107 to 128 (22 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 162 to 195 (34 residues), see Phobius details amino acids 246 to 269 (24 residues), see Phobius details PF13398: Peptidase_M50B" amino acids 47 to 257 (211 residues), 116.2 bits, see alignment E=8.1e-38

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (287 amino acids)

>mRNA_3448 HMMPfam-Peptidase M50B-like-PF13398 (Rhodosporidium toruloides IFO0880)
MYIPVADHIGYAFEHAAGYLTKRAKEEATKPFELTHTQWVTVHWIEACIIVLLFTWNLWL
ARSIIFPFKLCAVACHEGCHALAGLLTGAKVKSIVLDPNQGGTTRMIGGFAFCNIGSTLI
GSGLLFASFDQKASKIAAIPLFVHLTIVSLWARHSRFTLLNVTFIQGLILIFYIVAHGVF
LRFLLALIGCMNVMYSVWDQLDDLVFHASPALSTSRASTYPPCLQKINESDVCAFQRLYP
WLPAQVWGAIWTFVSCTGLTAAILGGIVTFKKDFAAQYFESQTFIPT