Protein Info for mRNA_3464 in Rhodosporidium toruloides IFO0880

Name: 11832
Annotation: K02684 PRI1 DNA primase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 TIGR00335: putative DNA primase, eukaryotic-type, small subunit" amino acids 52 to 393 (342 residues), 231 bits, see alignment E=1.2e-72 PF01896: DNA_primase_S" amino acids 147 to 379 (233 residues), 196.3 bits, see alignment E=2.3e-62

Best Hits

KEGG orthology group: K02684, DNA primase small subunit [EC: 2.7.7.-] (inferred from 49% identity to pno:SNOG_09645)

Predicted SEED Role

"DNA primase small subunit (EC 2.7.7.-)" in subsystem DNA replication, archaeal (EC 2.7.7.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.-

Use Curated BLAST to search for 2.7.7.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (452 amino acids)

>mRNA_3464 K02684 PRI1 DNA primase small subunit (Rhodosporidium toruloides IFO0880)
MPSMQVDSQQPITLPGPALDDLFADEQLASLLPKMENPTEESMGDLSNPMVMRTYYSRLL
PWKPMFLWLNQSHVPTRQFTHREFAFTLQNEAYLRYQSFHSHEELRKEVLRLNLSRFEIG
PMYSGRPKDRKALMKSAFRPLTRELVFDIDMTDYDSIRTCCKDKKMCKRCWKFITVAVKV
LDDLLRTDFGFTHILWVYSGRRGIHAWISDSSAMNLTDEQRSAIVRYIDAVKGYTNMEKR
LVLSRPLHPSINRAYEKSLKQAFAGVVLQDQDCFRTDPQQWENVVKMLPDKENAGHLLKQ
FPPTSSTASSVDRWTALAPAPSSSKESKHKAEKYKEAVTDIIVQYTYPRIDTEVSRKLNH
LLKAPFCIHPGTGKVCVPLLASQIDSFDPDTVPTVGRLLLELEDLARRGDSSADWGKTSL
RPYVELFERHAEGVVRERAREVKAEKAVSMEF