Protein Info for mRNA_3483 in Rhodosporidium toruloides IFO0880

Name: 11851
Annotation: KOG0683 Glutamine synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.

Predicted SEED Role

"Glutamine synthetase type II, eukaryotic (EC 6.3.1.2)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Glutamine synthetases or Peptidoglycan Biosynthesis (EC 6.3.1.2)

MetaCyc Pathways

• ammonia assimilation cycle III (3/3 steps found)
• L-glutamine biosynthesis I (1/1 steps found)
• ammonia assimilation cycle I (1/2 steps found)
• ammonia assimilation cycle II (1/2 steps found)
• L-aspartate degradation II (aerobic) (1/3 steps found)
• L-aspartate degradation II (anaerobic) (1/3 steps found)
• superpathway of ammonia assimilation (plants) (1/3 steps found)
• L-glutamate and L-glutamine biosynthesis (3/6 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Glutamate metabolism
• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.1.2

Use Curated BLAST to search for 6.3.1.2

Protein Sequence (53 amino acids)

>mRNA_3483 KOG0683 Glutamine synthetase (Rhodosporidium toruloides IFO0880)
VYGSDNDLRLTGRHETGHIGQFSWGVANRGSSIRVPKSVALAGKGYFEDRRPA