Protein Info for mRNA_3511 in Rhodosporidium toruloides IFO0880

Name: 11879
Annotation: K10875 RAD54L, RAD54 DNA repair and recombination protein RAD54 and RAD54-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 852 transmembrane" amino acids 528 to 545 (18 residues), see Phobius details PF08658: Rad54_N" amino acids 35 to 242 (208 residues), 116.4 bits, see alignment E=3.5e-37 PF04851: ResIII" amino acids 266 to 446 (181 residues), 41 bits, see alignment E=4.2e-14 PF00176: SNF2_N" amino acids 285 to 579 (295 residues), 184.2 bits, see alignment E=6e-58 PF00271: Helicase_C" amino acids 624 to 725 (102 residues), 53.6 bits, see alignment E=5.3e-18

Best Hits

KEGG orthology group: K10875, DNA repair and recombination protein RAD54 and RAD54-like protein [EC: 3.6.4.-] (inferred from 61% identity to uma:UM02083.1)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.-

Use Curated BLAST to search for 3.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (852 amino acids)

>mRNA_3511 K10875 RAD54L, RAD54 DNA repair and recombination protein RAD54 and RAD54-like protein (Rhodosporidium toruloides IFO0880)
MRRSFIAAIKQDAQAEPAAEPPHHSGAGFGVPQLKPFKVPTSTSATRSRQLGGTRSSTKR
PRVVFTENDFYTNVGSGIDADDDRGGKKAKKAAGKKKKGDDDSDDDGAKKKRGFGFVDKY
VPPPPPKQFPVYRPKAADSTITKAFTLPGIKKGGAILDTKLSLKPLGTRQAGEIIPAPLY
DPLDDHAIVLWDPTVDDREAEREMERLRKEKEEKERAEEDGKTALEKERKKVHKSLAEIL
GIADRKARAHLVKKVAVVIDPRLGSKLRPHQVEGVKFLYKCTTGMTDENAYGCIMADEMG
LGKTLQCITLMWTLLRQSPIPNKPAIDKAIVVCPSSLVKNWANELIKWLGPGTVNPLAVD
GKVTGAELIKEVRQWAASKGKQVVKPILIVSYESLREKIVDELNGTEVGLILADEGHRLK
NPTSATYNSIMQINCKRRVILTGTPIQNDLVEYFALINFCNPGYLGTATEFHKQYELAII
KGRDGDATDKQKEKGDEAMKALSEKVNRFIIRRTNDLLSRYLPVKYEHVVFCALSPFQLA
LYRFFMNSPEMKALLRGKDSQPLKAIGILRKLCNHPDIVDFAKDMPGAEACFAEGYDRND
RRRKLDPTLSGKMAVVDRFITKMRAETNDKIVLVSNFTTTLDMLEELCRIRRWGSLKLDG
TMDVRKRQKLVDQFNNPDSDKVVFLLSSKAGGCGINLIGANRLILYDPDWNPASDMQALA
RVWRDGQKKDCFVYRFVATGTVEEKIFQRQSHKQNLSSVVVDSKQDVERHYTGENLRQLF
LLKDSPCETHDLFKCKRCKNGRQFIKSPAMLYGDTSTWNHLTNDCLRNNHDSLLRAETGL
DSVTACFQYIST