Protein Info for mRNA_3514 in Rhodosporidium toruloides IFO0880

Name: 11882
Annotation: K18097 GCY1 glycerol 2-dehydrogenase (NADP+)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 54% identical to GAR1_HYPJE: D-galacturonate reductase (gar1) from Hypocrea jecorina

KEGG orthology group: None (inferred from 58% identity to lbc:LACBIDRAFT_331398)

MetaCyc: 54% identical to D-galacturonate reductase (Trichoderma reesei)
RXN-11151 [EC: 1.1.1.365]

Predicted SEED Role

"oxidoreductase of aldo/keto reductase family, subgroup 1"

MetaCyc Pathways

D-galacturonate degradation III (3/5 steps found)
L-ascorbate biosynthesis VII (plants, D-galacturonate pathway) (2/4 steps found)
L-ascorbate biosynthesis V (euglena, D-galacturonate pathway) (2/7 steps found)
superpathway of microbial D-galacturonate and D-glucuronate degradation (6/31 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.365

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (305 amino acids)

>mRNA_3514 K18097 GCY1 glycerol 2-dehydrogenase (NADP+) (Rhodosporidium toruloides IFO0880)
MPSYIDVPSFPLSHGGKAIPAVGLGTWQSNPGEVSNAVKIGLQNGYRHIDGAWIYGNEKE
VGEGIKASGVPREEIFVTSKLWCTKHRNVEAAVKESLELLGLDYLDLYLIHWPVPLNGQG
NDPKFPKLPDGSRDRDTEWSINQTWEQMEAILEKGFVKAIGVSNFSEAYLDQLLTTAKVV
PAVNQIELHPYLPQHELLEYLAKKDILAEAYSPLGSTDSPLLKDEDIQKIADKHGVSVGT
VLISYQVNRNVVVLPKSVTEKRIIDNYKIVKLDEEDMRTLNGLYKTKGKRFIKPDWGVDL
KFSHW