Protein Info for mRNA_3522 in Rhodosporidium toruloides IFO0880

Name: 11890
Annotation: K03008 RPB11, POLR2J DNA-directed RNA polymerase II subunit RPB11

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 130 PF13656: RNA_pol_L_2" amino acids 31 to 100 (70 residues), 89.3 bits, see alignment E=1.1e-29 PF01193: RNA_pol_L" amino acids 34 to 94 (61 residues), 33.6 bits, see alignment E=2.1e-12

Best Hits

Swiss-Prot: 50% identical to RPB11_HUMAN: DNA-directed RNA polymerase II subunit RPB11-a (POLR2J) from Homo sapiens

KEGG orthology group: K03008, DNA-directed RNA polymerase II subunit RPB11 (inferred from 50% identity to lbc:LACBIDRAFT_190677)

Predicted SEED Role

"DNA-directed RNA polymerase II 13.3 kDa polypeptide (EC 2.7.7.6)" in subsystem RNA polymerase II (EC 2.7.7.6)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.6

Use Curated BLAST to search for 2.7.7.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (130 amino acids)

>mRNA_3522 K03008 RPB11, POLR2J DNA-directed RNA polymerase II subunit RPB11 (Rhodosporidium toruloides IFO0880)
MNAPSRYEMFVLNDGEAKVEVVEDTKIPNAATLTINKEDHTLANMLRSQLLLFPYVQFAG
YKVPHPLEPRVVLKVQTDGSRTPLVAVQEAINTLLILLGKVRSQFQQEAVRARALEGTED
QFAGAGEGFF