Protein Info for mRNA_3552 in Rhodosporidium toruloides IFO0880

Name: 11920
Annotation: K10884 XRCC6, KU70, G22P1 ATP-dependent DNA helicase 2 subunit 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 TIGR00578: ATP-dependent DNA helicase II, 70 kDa subunit (ku70)" amino acids 81 to 655 (575 residues), 220 bits, see alignment E=2.5e-69 PF03731: Ku_N" amino acids 82 to 258 (177 residues), 58.7 bits, see alignment E=1.5e-19 PF02735: Ku" amino acids 298 to 503 (206 residues), 133.6 bits, see alignment E=1.6e-42 PF03730: Ku_C" amino acids 525 to 602 (78 residues), 68.7 bits, see alignment E=1.2e-22 PF02037: SAP" amino acids 625 to 658 (34 residues), 33.2 bits, see alignment (E = 6.8e-12)

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (700 amino acids)

>mRNA_3552 K10884 XRCC6, KU70, G22P1 ATP-dependent DNA helicase 2 subunit 1 (Rhodosporidium toruloides IFO0880)
MSRSFGRYDEWTAGVDSDDEDDLQEDYRYTKDSILWCIEATPTMLEPMLAPSSSHPSDPT
PTSTAAPSTQANAVVWKGSPAKSKMEECLRAAYAMMKRKVIASPKDHVGIVIWNTASSHG
DVGDNCYLLLPLQQITAQNIRFLKDLLEKAEADDNFLAEKFRPNEGQNIVANVFSLANNA
FRELTPNANNRAYWVTDNDDPIKGVEQLLHVAKAKRMDLYDMKFHIETFFVPPTFGSEFD
LNKFYGEVITLEGDEEGEGVAEPVVNLDLRTALEGMITAMRTKESQKRVAFKIPFVLGKD
LSIGIVGYNMIGEETKKLPTKVDLNTQGGQEVVSKTVYKDSETGAVLDKKDIKKYFQVGR
DDFEKGTEAAKIFFNETDVRKVKTLGRPPSLKLLGFKPREGNLRFWETVKHSYFIYPDED
RYSGSTRTFASLLKTMIKKDVIGYASFIPRTISRPQVAEKLNAAGVAIEPNGIHVCQLPF
ADDIRDIAIESTISVVHKPTEEDEDPDQPEINLANKIIKYFTKPYNPDVYPNPALNYFYE
TLAAVALDEEIPEPDDRTLPLYETIHARVGKYAAKLKELIPPDQVDPTRIKTSNKKRVVK
KDAADPNEPPPDLSEFVDDLKQYGNKLTVANLKAALKQMGEKTSGNKPELMERAVGYLVE
HGLWEEKKAKDEMDVDEDEEEKKPRIKKKRKVIIDDEEED