Protein Info for mRNA_3619 in Rhodosporidium toruloides IFO0880

Name: 11987
Annotation: HMMPfam-X-Pro dipeptidyl-peptidase (S15 family)-PF02129,HMMPfam-X-Pro dipeptidyl-peptidase C-terminal non-catalytic domain-PF08530,SMART-X-Pro dipeptidyl-peptidase C-terminal non-catalytic domain-SM00939,SUPERFAMILY--SSF49785,SUPERFAMILY--SSF53474,TIGRFAM-/NonD hydrolase CocE/NonD family protein-TIGR00976

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 TIGR00976: hydrolase CocE/NonD family protein" amino acids 30 to 600 (571 residues), 186.4 bits, see alignment E=5.8e-59 PF02129: Peptidase_S15" amino acids 34 to 317 (284 residues), 135.5 bits, see alignment E=2.8e-43 PF08530: PepX_C" amino acids 354 to 595 (242 residues), 110.3 bits, see alignment E=1.5e-35

Best Hits

KEGG orthology group: None (inferred from 53% identity to fgr:FG04970.1)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (600 amino acids)

>mRNA_3619 HMMPfam-X-Pro dipeptidyl-peptidase (S15 family)-PF02129,HMMPfam-X-Pro dipeptidyl-peptidase C-terminal non-catalytic domain-PF08530,SMART-X-Pro dipeptidyl-peptidase C-terminal non-catalytic domain-SM00939,SUPERFAMILY--SSF49785,SUPERFAMILY--SSF53474,TIGRFAM-/NonD hydrolase CocE/NonD family protein-TIGR00976 (Rhodosporidium toruloides IFO0880)
MTIPHPIPGSNAIRRTERRANLVFDKNVDVPMKDGGLCRANVYLPLEEGRYPVIMTMGPY
GKDAPYSEFHVKSFKELPDEQKSDLSAWETPHPDYWVSQGYVVVRIDERGNGSSPGYLDT
MSASTSSDFAECVEWAAVQPWSTGKIGLLGISYYGGTQWRVAARKPKGLTCIIPWEGMTD
YYRDRVRQGGILSNQFVKFWWNNQVVTMQYGNGEKSVRRWGPNSLVGEPIGPECQEGVIL
PEKLATLRSDQTIDNAKYRYLDEPYHASRVYNLGDIEVPVLSVANLGGNTLHLRGNVMGY
LEAGTKNKWLWFISGRHDLPFYLPHYVELQKSFLDAWLKGKDSRGWTKGPNNGVPAVNVL
VRKGNPGFNSTAAEATFANRPETSWPIERTRYEKFHLHPDLSMRLDSPATESAQLKLAGL
GKSDPIQFKVTFDKETEIAGHPLANLVVGVEKREDGTAPKDVDLFVTVRHFDADGKEIFY
TGTAGDPVPLVKGWLRASLRKIDENSPRHRAYLPHRNYLSTDVSYLEPDTPYDCLVEIWP
TAVVVSPGSRIVFEVATGDTQGAAIFLHHEQTDRSEEDFGGTNVIHFGEAHQNWLQLPIV