Protein Info for mRNA_3628 in Rhodosporidium toruloides IFO0880

Name: 11996
Annotation: K10849 ERCC1 DNA excision repair protein ERCC-1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00597: DNA repair protein rad10
  • amino acids 109 to 220 (112 residues), 145.2 bits, E=3.3e-47
• PF03834: Rad10
  • amino acids 110 to 223 (114 residues), 155.9 bits, E=3.9e-50
• PF14520: HHH_5
  • amino acids 249 to 298 (50 residues), 32.7 bits, 9.3e-12

Predicted SEED Role

No annotation

Protein Sequence (332 amino acids)

>mRNA_3628 K10849 ERCC1 DNA excision repair protein ERCC-1 (Rhodosporidium toruloides IFO0880)
MSAQPGPSKSPAASASSAAASSSSSVRPSTPGAFSTNTPRQGTPAGGQSAVQRGKQPATP
GGPVQAGAGGGARVVQPGGGGASAGQAQGVRVVNAGAASGPAVIRPTLNSILVNVRQKGN
PVIGHIRTVPWEYGDIKCDYQVGATAGVLYLSIRYHLLHPEYIHTRIQDLGQNYNLRIIL
CQCDTDNHTAAMKELTKVAIVNGYTLITCWSAQEAGRYLETYKSFERKPPDLIRERVDDS
YMAHMTSALTSVRGVNKLDVTTLISNFGSFANLVLAEPAKLSTLPGLGDKKVRRLREAFT
APFTTSGGKNKRRRVEKGEAEKRGERGEREIN